KEGG   Serratia sp. AS13: SerAS13_0657Help
Entry
SerAS13_0657      CDS       T02012                                 

Definition
(GenBank) Protein ApaG
  KO
K06195  ApaG protein
Organism
sra  Serratia sp. AS13
Brite
KEGG Orthology (KO) [BR:sra00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    SerAS13_0657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AEG26472
Position
complement(732879..733256)
Genome map
AA seq 125 aa AA seqDB search
MIDSPRVCIQVQSIYVESQSIPEEERYVFAYTITIRNLGRFNVQLLGRYWLITNANGRQT
EVQGEGVVGEQPLIQPGGEFQYTSGAVLETPLGTMEGHYEMVDHQGQPFRTAIPVFRLAI
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattgattcgccccgtgtatgtattcaggtacaaagtatctacgtggaatcacagtcg
atacctgaagaagaacgttacgtcttcgcttataccatcaccatccgcaacctggggcgt
ttcaacgtgcagctgctgggccgctattggctaatcaccaacgccaatggccgccaaacc
gaagttcagggcgaaggcgtggtcggcgaacagccgctcattcagcccggcggtgaattc
caatataccagcggcgcggttcttgaaacgccgttgggtaccatggaaggccattacgaa
atggttgatcatcagggtcagccattccgcactgccattcccgtgttccgcttagctatc
ccaacactgattcactaa

DBGET integrated database retrieval system