KEGG   Serratia sp. AS13: SerAS13_1218Help
Entry
SerAS13_1218      CDS       T02012                                 

Definition
(GenBank) osmosensitive K+ channel signal transduction histidine kinase
  KO
K07646  two-component system, OmpR family, sensor histidine kinase KdpD [EC:2.7.13.3]
Organism
sra  Serratia sp. AS13
Pathway
sra02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sra00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SerAS13_1218
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sra01001]
    SerAS13_1218
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sra02022]
    SerAS13_1218
Enzymes [BR:sra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     SerAS13_1218
Protein kinases [BR:sra01001]
 Histidine kinases
  OmpR family
   SerAS13_1218
Two-component system [BR:sra02022]
 OmpR family
  KdpD-KdpE (potassium transport)
   SerAS13_1218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: KdpD DUF4118 HATPase_c GAF_3 HisKA Usp DUF2478 DUF2975
Motif
Other DBs
NCBI-ProteinID: AEG27017
Position
complement(1332878..1335571)
Genome map
AA seq 897 aa AA seqDB search
MVEEEQQRPDPDSLLAVANEKPRGRLKVFFGACAGVGKTYAMLQEAQRLRGQGLDVLVGV
VETHGRSETAALLTGLDVLAKKRIQYRGRLVQEFDLDAALARHPALVLMDELAHSNAQGS
RHPKRWQDVEELLDAGIDVLTTVNVQHLESLNDVVGGVTGVRVRETVPDHVFDEATEVVL
VDLPPDDLRQRLNEGKVYIPGQAERAIEHFFRKGNLIALRELALRRTADRVDDQMRAFRD
TQGREKVWHTRDSILLCVGHNSGNEKLVRIAARLAARLGCHWHAVYVETPKLHRLPENQR
RAILRALRLAQELGAETATLSDPSEERAVLRYAREHNLGKIIIGRRGEQRWKLRGSFADR
LGRLGPDLDLVIVALENDSFAQPGKEHDGRNFSEKWRMQLRGCAVAVALCALITLLSQWL
LPGFDQANLVMVYLLGVAIVALFFGRWPSVLAAVINVASFDLFFVQPEWSFAVSDMQYLL
TFGVMLIVGITIGNLTAGVRYQARVARYREQRARHLYEISRGLSQALTPEDIAKTSRHFL
SSSFQAKTVLLLPQEDGKLHQMVGEAGGLLSVDEAIARWSFDKGMPAGAGTDTLPGVPYQ
LLPLTASKQTFGLLAIEPGNLRQLMVPEQQRLLQTFAVLIASALERLHLARSAEEAKLDA
EREQLRNSLLAALSHDLRTPLTVLFGQAEILTLDLAAEGSSHAPQASQIRQQVLSTTRLV
NNLLDMARIQSGGFNLRKEWQSLEEIVGASLHMLEPLLTQHQIKVELPPELVLVNCDGSL
LERVFTNLLENANKYAGIDAIIGIRAHTLPEWLEVEVWDNGPGIPEGKKQLIFDKFARGN
KESAIPGVGLGLAICRAIIEVHGGRIWAENGANGGASFRFVLPLEKPPEIDGESFDL
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaagaagaacagcagcgccccgatcctgacagcctgctggcggtagccaatgaa
aaaccgcgcggccggctgaaggtgttcttcggcgcctgcgccggagtgggcaaaacttac
gccatgctgcaagaagcacagcgcctgcgcggccaggggctggacgtgctggtcggcgta
gtcgaaacccacggacgctccgaaaccgctgcgctgctgaccggcctggacgtgctggcg
aaaaaacgcatccagtatcgcggccggctggtacaggagtttgatctcgatgccgcgctg
gcgcgccatcctgcgctggtgctgatggacgaactggcgcacagcaatgcccaaggctcg
cgtcacccgaaacgctggcaggatgtagaagagttgctggacgccggtatcgacgtgctc
accaccgtgaacgtgcagcatctggagagcctgaacgacgtggtcggcggcgtaaccggc
gtgcgggtacgcgagaccgtgcccgatcacgtcttcgacgaagcgaccgaagtggtgctg
gtcgatctgccgccggacgatctgcgccaacggctaaatgaaggcaaggtgtatatcccc
ggccaggccgaacgcgccatcgagcacttcttccgcaaaggcaacctgatcgccctgcgc
gagctggctctgcgccgcaccgccgatcgggtcgatgatcaaatgcgcgcctttcgcgat
acccagggccgagaaaaagtgtggcacacccgcgacagcattttgctgtgcgtcggccac
aacagcggcaacgaaaagctggtgcgcatcgccgcccggctggcggctcgtctgggctgc
cactggcatgcggtgtatgtggaaacgccgaagctgcaccggctgccggaaaaccaacgc
agggcgatcctgcgggcattgcgtctggcacaggagctaggtgccgaaaccgccaccctg
tccgacccttccgaagaacgtgcggtgctgcgctacgcccgcgagcataacctgggcaaa
atcattatcggccggcgtggcgagcagcgttggaaactgcgcggcagctttgccgatcgt
cttggccgcttggggccggatctcgatttggtgatcgtcgcactggaaaacgacagcttc
gcgcagcccggtaaagagcatgacggtcgtaatttttccgagaaatggcgcatgcaattg
cgcggctgcgccgtcgccgtggcgctgtgcgccctgatcaccctgctctcccagtggctg
ttgccgggatttgaccaagctaacctggtgatggtgtatctgctcggcgtggcgatcgtc
gcgctgttcttcggccgctggccgtcggtgctggccgcggtaatcaacgtcgccagtttt
gatctgtttttcgtccagcccgaatggtcgtttgccgtcagcgatatgcagtatctgctg
accttcggcgtcatgttgatcgtcggcatcaccatcggcaacctgaccgccggggtacgc
tatcaggctcgcgtcgcccgctaccgcgaacagcgggcccgccacctgtatgagatttca
cgcggcctgagccaggcgctgacccccgaagatatcgccaaaaccagccgccatttcctc
tccagcagcttccaggcaaaaaccgtgctgctgttgccacaagaggacggcaagctgcac
cagatggtcggcgaggccggtggcttgttgtcggtagatgaagccattgcccgctggagc
tttgacaaggggatgccggccggcgccggcaccgatacactgcctggcgtgccttatcaa
ctgctgccgttaaccgcctcgaagcagaccttcggcctgttggctatcgaacccggtaac
ctgcgccagttgatggtacctgagcaacagcggctgctgcagacctttgcggtgctgatc
gccagcgcgctggagcgactgcacctggcgcgcagcgccgaggaagccaagctggacgcc
gagcgtgaacagctgcgcaactctctgctggcagcgctgtcccacgatttgcgcaccccg
ctgacggtgctgttcggccaggcggaaattttgacgctcgatctggcggccgaaggctcc
agtcacgcaccgcaggccagccagatccgccagcaggtactgagcaccacccggctggtg
aataacctgctggatatggcgcgcattcagtccggcggctttaacctgcgtaaagagtgg
caatcgctggaagagatcgtcggcgcatcgctgcatatgctggagccgctgctgacccaa
caccagatcaaggtcgagttgccgcctgagctggtgctggtcaattgcgacggcagcctg
ttggaacgcgtcttcactaacctgttggaaaacgccaataaatacgccggcatcgatgct
attatcggcattcgcgcccatactctgccggagtggctggaagtcgaagtctgggacaat
ggccccggcattcccgaagggaaaaaacagctgattttcgataaattcgcccgcggcaat
aaagagtcggcaatccccggcgtggggttggggttagcgatttgccgtgccattattgaa
gtgcacggcggccgcatctgggcggaaaacggcgccaacggcggtgccagtttccgtttt
gttcttccgctggagaaaccgcccgaaattgacggcgaatcctttgatctgtaa

DBGET integrated database retrieval system