KEGG   Serratia sp. AS13: SerAS13_2384Help
Entry
SerAS13_2384      CDS       T02012                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sra  Serratia sp. AS13
Pathway
sra00010  Glycolysis / Gluconeogenesis
sra00071  Fatty acid degradation
sra00350  Tyrosine metabolism
sra00625  Chloroalkane and chloroalkene degradation
sra00626  Naphthalene degradation
sra01100  Metabolic pathways
sra01110  Biosynthesis of secondary metabolites
sra01120  Microbial metabolism in diverse environments
sra01130  Biosynthesis of antibiotics
sra01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SerAS13_2384
  Lipid metabolism
   00071 Fatty acid degradation
    SerAS13_2384
  Amino acid metabolism
   00350 Tyrosine metabolism
    SerAS13_2384
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SerAS13_2384
   00626 Naphthalene degradation
    SerAS13_2384
Enzymes [BR:sra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SerAS13_2384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AEG28167
Position
complement(2554284..2555309)
Genome map
AA seq 341 aa AA seqDB search
MKTMKAAVVTAFGQPLVIKEVPIPEVAPGKILVKIAATGVCHTDLHAADGDWPIKPNPPF
IPGHEGSGHVVAVGAGVTHVKEGDRVGVPWLYSACGHCEHCLGGWETLCHSQQNSGYSVN
GSFAEYCLADANYVGILPDNVDFLSISPILCAGVTVYKGLKMTNTKAGDWVVISGIGGLG
HLAIQYATAMGLNVAAVDIDDDKLAFAKSLGASVVANARNVDPGRFFHQEFGGAHGVLVT
AVSPKAFEQATTVMRRGGTMVLNGLPPGSFDLSIFNMVLEGTTVRGSIVGTRKDLQEALD
FAGRKKVAATISVEPLEQINDIFSRMREGKITGRVVVDMSL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgatgaaagctgctgtggtgactgcgtttggacaaccgttggtgattaaagag
gtcccgatcccggaggtcgcgcccggaaaaatcctggtcaagattgccgccaccggggtg
tgccataccgatctgcacgcagccgacggtgactggccgatcaaacccaacccgcctttt
attcctgggcatgagggctccggtcacgtcgtggcggtgggcgccggcgttacccacgta
aaagagggtgatcgcgtaggggtgccctggctttactctgcctgcgggcactgtgaacac
tgtctcggcggctgggaaacgctgtgccattcccagcaaaactcgggctattcggttaac
ggcagctttgccgaatactgcctggccgatgccaattacgtgggtattctgcccgataac
gtcgattttctgtctatctcaccgatcctctgtgccggcgtcaccgtctataaggggctg
aaaatgaccaataccaaggccggcgactgggtggtcatttccggcatcggcggtcttggg
catctggcgatccaatacgccaccgctatggggttgaacgtggcggcggtcgatattgac
gatgacaaactggccttcgccaaaagtctgggcgcttcggtggtagctaacgcgcgaaac
gtcgatcctggccgctttttccatcaggagttcggtggcgcgcacggcgtgctggtgacg
gcggtatcgccaaaggcatttgaacaggcgaccaccgtgatgcgacgaggcggcaccatg
gtattgaacggcctgccgccaggcagttttgacctttcaatcttcaatatggtgctggaa
ggcacgacggtgcgcggttcgattgtcggtacgcgcaaggatctgcaagaggcactggac
tttgccggccgtaagaaagtcgcggcaaccatctcggtagagccgctggagcaaatcaac
gacatcttcagccgcatgcgtgagggcaaaatcaccggccgcgtggtggtggatatgtcg
ctttaa

DBGET integrated database retrieval system