KEGG   Serratia sp. AS13: SerAS13_2419Help
Entry
SerAS13_2419      CDS       T02012                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sra  Serratia sp. AS13
Pathway
sra00010  Glycolysis / Gluconeogenesis
sra00020  Citrate cycle (TCA cycle)
sra00620  Pyruvate metabolism
sra01100  Metabolic pathways
sra01110  Biosynthesis of secondary metabolites
sra01120  Microbial metabolism in diverse environments
sra01130  Biosynthesis of antibiotics
sra01200  Carbon metabolism
Module
sra_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SerAS13_2419
   00020 Citrate cycle (TCA cycle)
    SerAS13_2419
   00620 Pyruvate metabolism
    SerAS13_2419
Enzymes [BR:sra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SerAS13_2419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AEG28201
Position
complement(2602061..2603317)
Genome map
AA seq 418 aa AA seqDB search
MPEIRHAVVPDIGDDQPIPLVEILVAVGDYIALNQGLITLESDKATLEIPATFSGRVTEL
LVKPNDRLSAGSPIAAIEVEEETPSEPLPVNVAVPAPSPVPAMPVAVREPTAPARPGTAA
YASPLVYRLARELGVDLQRLTGSARQGRITRNDVMQHVRSALSAQPQATSTLAAALLPWP
EVDFSRFGETERRPLTRIQTMSAANLSRNWALIPHVTHHDHADITELEALRATLNRENGP
EGVKITLLAFLLKASSVALRAFPQFNASLDIDGKQLIMKKYLHIGFAVETPQGLVVPVVR
NVDEKSVTQLAQEIAALSKKAREGVLTASEMSGGCFTLSSLGGIGGLAFTPIINAPEVAI
LGISTACWQPVWDDREFIPRLLLPLSLSYDHRVIDGALAARFSVYLTGLLADIRRLLL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaataagacatgccgtggtgccggacatcggcgacgaccagccaattccgctg
gtcgagatactggttgccgtgggggattacattgcgctgaaccaggggttgattaccctg
gaatccgacaaggcgacgctggagatccccgccaccttcagtggccgcgtcaccgagctg
ctggtcaaaccgaatgacaggctgtcggccggtagcccgatcgccgccattgaggtcgaa
gaagagacgccaagcgaaccgctgccggtgaacgttgccgtaccagcgccctcacccgtg
ccggccatgcccgttgccgtcagagaaccgacagcgccggcccgcccgggtactgcagct
tatgccagtccgctggtgtaccgtttggctcgcgagcttggggtggacctgcagcggtta
accggcagcgcccgacaggggcgcattacccgcaatgacgttatgcaacatgtcagatcc
gctctgagcgctcaacctcaggcaacgtcaacactcgcagcggcgttgctgccgtggcct
gaggtcgatttcagccggttcggcgaaaccgaacgccggccgctaacgaggatccaaacg
atgtcggccgctaacctgagccgaaactgggcgttgatcccgcatgtaacgcaccatgat
catgccgatattaccgagttggaagcgctgcgggcaacgctgaaccgtgaaaacggcccg
gaaggcgtgaaaattaccctgctggcatttctgctcaaagccagctccgtcgcgttaagg
gcgtttcctcagttcaatgcttcgctggatatcgacggcaaacagctgattatgaagaag
tacctgcacattggttttgccgtggaaacaccacagggattggtggtgccggtagtgcgc
aacgtcgatgaaaaaagcgtgacgcagttggcgcaggagatcgccgcattgagcaaaaag
gcgcgtgaaggcgtattgacagcctcagagatgagcggtggctgcttcacgttgtcctcg
ctggggggcattggcgggctggcgtttaccccgatcatcaatgcgccggaggtcgcgata
ctggggatctcgaccgcgtgttggcaaccggtgtgggacgatagggagtttattccccgc
ctgctgttgccgttgtcgctgagctacgaccaccgggtgattgacggtgccctcgccgct
cgttttagcgtttatctgaccggtctgttggccgatatccgccgtctgttactctga

DBGET integrated database retrieval system