KEGG   Serratia sp. AS13: SerAS13_3107Help
Entry
SerAS13_3107      CDS       T02012                                 

Definition
(GenBank) 3-oxoacid CoA-transferase, A subunit
  KO
K01031  3-oxoadipate CoA-transferase, alpha subunit [EC:2.8.3.6]
Organism
sra  Serratia sp. AS13
Pathway
sra00362  Benzoate degradation
sra01100  Metabolic pathways
sra01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sra00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SerAS13_3107
Enzymes [BR:sra01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.6  3-oxoadipate CoA-transferase
     SerAS13_3107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: AEG28882
Position
3299277..3299963
Genome map
AA seq 228 aa AA seqDB search
MIDKNVASADAAVADIPDGATLMVGGFGPAGQPCALLDALIRHRPRELTLISNNAGNGDF
GLAALLKAGCVRKVVCSFPRQSDSWVFDDLYRRGELELELIPQGNLAARIQAGGSGLGGF
YTPTGYGTKLAEGKETREIDGRQYVFELPLKADFALIKAEKGDRWGNLLYSKTGRNFGPI
MAMAAHCTIAEINQLVPLGQLDPETIITPGIFVQRLVTSPASAAQLSA
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgatcgataaaaacgtggcatccgcagacgccgccgtcgccgatataccggatggcgcc
acccttatggtcggcggttttggcccggccggccagccctgtgccctgctggatgcgctg
atccgtcaccgcccgcgcgagctgacgctgatcagcaataacgccggtaacggggatttc
ggcctggctgcgctgctgaaggccggctgtgtacgcaaagtggtatgctctttcccgcgc
cagtccgactcctgggtatttgacgatctgtaccgccgcggcgaactggaactggagctg
atccctcagggcaatctggccgcccgcattcaggccggcggttccggcctcggcggcttc
tacacgccgaccggttacggcaccaaactggcggaaggcaaggaaacccgtgagatagac
ggccgccagtacgtatttgaactgccgctaaaggccgattttgctctgatcaaggctgaa
aaaggcgaccgctggggcaatctgctgtattccaaaaccgggcgcaacttcgggccgatc
atggcgatggccgcccattgcaccatcgctgaaatcaatcaactggtgccactgggccag
ttggatcctgaaaccatcatcacgccggggatcttcgtgcaacgcctggtaacctccccg
gcaagcgcagcgcaactgtcggcttaa

DBGET integrated database retrieval system