KEGG   Serratia sp. AS13: SerAS13_3527Help
Entry
SerAS13_3527      CDS       T02012                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
sra  Serratia sp. AS13
Pathway
sra00130  Ubiquinone and other terpenoid-quinone biosynthesis
sra00627  Aminobenzoate degradation
sra01100  Metabolic pathways
sra01110  Biosynthesis of secondary metabolites
sra01120  Microbial metabolism in diverse environments
sra01220  Degradation of aromatic compounds
Module
sra_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:sra00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    SerAS13_3527
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SerAS13_3527
Enzymes [BR:sra01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     SerAS13_3527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: AEG29293
Position
complement(3760413..3760985)
Genome map
AA seq 190 aa AA seqDB search
MKRLIIGISGASGAIYGVRLLQALRDVAEVETHLVMSNAARQTLSLETELGLREVQALAD
VVHDARDIGASISSGSFKTLGMVILPCSIKTLSGIANSYSDGLLTRAADVVLKERRRLVL
CVRETPLHIGHLRLMTQAAEMGAVIMPPVPAFYHQPKSVDDIIDQTVNRVVDQFDIELPK
DLFTRWQGSN
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgactcatcatcggtatttccggcgccagcggcgcaatctacggcgtgcgcctg
ttgcaggcattgcgcgacgtcgcagaggtggaaacccatttggtgatgagcaacgcggcg
cggcaaacgctttcgctggaaaccgagcttggcctgcgtgaagtgcaggcgttggctgac
gtggtgcatgacgcacgcgacatcggtgccagcatttcttccggttcgttcaaaaccctg
ggtatggtgattttaccttgctcaatcaagacgttatccggtatcgccaacagctatagc
gacggcctgctgacgcgcgccgccgatgtagtcctgaaggagcgccgccggctggtgctg
tgcgtgcgtgaaaccccgttgcatataggccatttacgcctgatgacgcaggctgcggaa
atgggcgcggtgatcatgccaccggtaccggctttttatcaccaaccgaaaagcgtcgat
gacatcatcgatcaaaccgtgaatcgggtggtggatcagttcgacattgaattaccgaaa
gatttgttcacccgctggcaaggctccaattaa

DBGET integrated database retrieval system