KEGG   Serratia sp. AS13: SerAS13_4864Help
Entry
SerAS13_4864      CDS       T02012                                 

Definition
(GenBank) Glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
sra  Serratia sp. AS13
Pathway
sra00471  D-Glutamine and D-glutamate metabolism
sra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sra00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SerAS13_4864
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sra01011]
    SerAS13_4864
Enzymes [BR:sra01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     SerAS13_4864
Peptidoglycan biosynthesis and degradation proteins [BR:sra01011]
 Precursor biosynthesis
  Racemase
   SerAS13_4864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AEG30615
Position
complement(5263391..5264254)
Genome map
AA seq 287 aa AA seqDB search
MATLLQEENTTSLEAIPSNTTAKTRPTVLVFDSGVGGLSVYQEVRQLLPDLHYIYAFDNV
AFPYGEKSEEFIVERVLEIVGAVQQRHPLAIVVIACNTASTVSLPALRERFTFPVVGVVP
AIKPAARLTANGVVGLLATRGTVQRTYTHELIARFATDCKIELLGSSELVELAEAKLHGE
AVPLATLKKILHPWLSMREPPDTVVLGCTHFPLLAEELMQVLPEGTRLVDSGAAIARRTA
WLISSQENLVSTQEDNLAYCMALNEDTDALLPVLQGYGFKSLKKLPL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggctacgctactccaggaagagaatactacctcactggaagctataccttctaacacc
accgcgaagacccgtccgacggtgctggtatttgattccggcgtcggcgggctgtcggtg
tatcaggaggttcggcaactgctgccggacctccactatatatacgctttcgataatgtg
gcgttcccctacggcgagaaatccgaagagtttatcgttgaacgcgtgctggagattgtc
ggcgcggtgcaacagcggcatcctttggcgattgtcgtcatcgcctgtaataccgccagt
accgtatccttaccggccttacgtgaacgctttacctttccggtcgttggtgtggtacct
gccatcaaacctgccgcccgtctgaccgccaatggcgttgtcggcctgctggctactcgc
ggtaccgtacagcgcacttatacccatgagttgattgcccgcttcgctaccgattgcaag
atcgagctattgggatcttcagagctggtggaactggcggaagccaagctgcacggtgaa
gccgtaccgctggccacgctgaagaaaattctgcatccatggctgagcatgcgtgagcca
ccggataccgtggtactcggttgcacccacttccctctattagcagaagagttaatgcag
gtgttgcctgagggaacccgactggtggattccggcgcggctattgcccgtcgtaccgct
tggcttatttcttcgcaggaaaatctggtatcgactcaggaagataatctggcgtattgc
atggcgttgaatgaagacactgacgctttattgcccgttttgcagggatatggctttaaa
tcgttgaaaaaactgcctctttaa

DBGET integrated database retrieval system