KEGG   Streptomyces rapamycinicus: M271_06045Help
Entry
M271_06045        CDS       T02907                                 

Definition
(GenBank) glucose-1-dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
src  Streptomyces rapamycinicus
Pathway
src00030  Pentose phosphate pathway
src01100  Metabolic pathways
src01120  Microbial metabolism in diverse environments
src01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:src00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    M271_06045
Enzymes [BR:src01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     M271_06045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF1776 Epimerase TIR_2
Motif
Other DBs
NCBI-ProteinID: AGP52835
Position
1602819..1603658
Genome map
AA seq 279 aa AA seqDB search
MNSNPDRPPPVHVPELLKGQKALVTGANSGIGKATAIALGRSGADVVVNYASDRPAAEAV
VAEIQSHGVRAYAHQADVSQEDQVVDLVSTMVDRLGTIDILVANAGLQRDAPTTEMTLEQ
WQKVISVNLTGQFLCAREAIKEFLRRGVVPEVSRAAGKVICMSSVHQTIPWAGHVNYASS
KGGVAMLTQTLAQEFAPHKIRVNAIAPGAVKTPINRGAWQTPEARDSLLRLIPYGRVGDT
LDIANAAVVLASDLCDYVVGTTLYVDGGMTLFPGFATGG
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
gtgaacagcaatcccgatcgtcctcctccggtgcacgtcccggaactcctcaaggggcag
aaggcgctggtcaccggggcgaactcggggatcggaaaggccaccgcgatcgcgctgggg
cgctccggcgccgatgtggtggtcaactacgccagtgaccggccggccgccgaggccgtc
gtcgccgagatccagagccacggtgtgcgggcctacgcccatcaggcggatgtgtcccag
gaggaccaggtcgtcgacctggtgtccaccatggtcgaccgtctgggcaccatcgacatc
ctcgtcgccaacgcggggctccagcgggacgcgcccaccaccgagatgacgctcgaacag
tggcagaaggtcatctccgtcaacctcaccggccagttcctgtgcgcccgggaggccatc
aaggagttcctgcggcgcggtgtggtcccggaggtgtcgcgggcggccgggaaggtcatc
tgcatgagctcggtgcaccagaccatcccctgggccggccatgtgaactacgcgtcgtcc
aagggcggcgtggcgatgctgacgcagaccctggcccaggagttcgcaccccataagatc
cgggtgaacgcgatcgcgccgggcgccgtcaagaccccgatcaaccgcggcgcctggcag
acccccgaggcacgcgactccctcctgcggctcatcccgtacggccgcgtgggcgacacc
ctggacatcgccaacgccgccgtcgtcctggcctccgacctgtgcgactacgtggtgggc
accaccctctacgtcgacggcggcatgaccctcttcccgggcttcgccacgggtggctga

DBGET integrated database retrieval system