KEGG   Streptomyces rapamycinicus: M271_07260Help
Entry
M271_07260        CDS       T02907                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
src  Streptomyces rapamycinicus
Pathway
src00625  Chloroalkane and chloroalkene degradation
src00680  Methane metabolism
src01100  Metabolic pathways
src01120  Microbial metabolism in diverse environments
src01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:src00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    M271_07260
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    M271_07260
Enzymes [BR:src01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     M271_07260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C HI0933_like ADH_zinc_N_2 AlaDh_PNT_C FAD_oxidored FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AGP53073
Position
complement(1914850..1916115)
Genome map
AA seq 421 aa AA seqDB search
MRRASHGGSLEVPGGGRDTLGTFRVRHHRRLSAIDAEVIQVKAVVYEKPYSVAVRDVDDP
RIEHPNDVIVRVTSSAICGSDLHMYEGRTAAEPGIVFGHENLGVVEETGSGVVSLSKGDR
VVMPFNVACGFCKNCLAGDTGFCLTVNPGFAGGAYGYVAMGPYKGGQADRLRVPFADFNC
LKLPQGDELETDFILLADIFPTGYHGCELAQVSPGESVAVYGAGPVGLMAAYSALLRGAA
TVFVVDRVPERLAKATEIGAVPIDFSKGDPVPQIVDRTGGEGTDKGIDAVGYQAQAHDAS
HEEPASVLNSLVDTVRPTGRLGVPGLYVPSDPGGPDEHAKRGQLLVSIGRMFEKGQRMGT
GQCNVKRYNRQLRDMIIAGRARPSFVVSHELPLDQAPQAYEKFDKRVEGYTKVVLHPALA
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
ttgcgccgggcgtcccatggcggttcgctggaagtacccggtggtggccgagacaccctg
ggaacgttccgtgtccgccaccaccgccgcctgtcagcgatcgacgcggaggtgatccag
gtgaaagccgtcgtctatgagaagccctactcggtggcggtgagggacgtcgacgatcct
cggatcgagcatccgaacgatgtaatcgtgcgcgtcacctccagcgcgatctgcggctcc
gatctgcatatgtacgagggccggacggcggccgagcccggcatcgtcttcgggcacgag
aacctcggtgtggtcgaggagaccggttccggcgtcgtctcgctctccaagggcgaccgc
gtggtcatgccgttcaacgtggcctgcggattctgcaagaactgcctcgcgggcgacacc
ggcttctgtctcaccgtcaacccgggcttcgcgggcggcgcctacggctatgtggcgatg
ggcccgtacaagggcggccaggccgatcggctgcgggtgcccttcgccgacttcaactgc
ctgaagctgccccagggcgatgagctcgagaccgacttcatcctgctcgccgacatcttc
ccgaccggctaccacggctgtgagctggcccaggtctccccgggcgagagcgtggccgtc
tacggcgccggcccggtggggctgatggccgcctactccgcgctgctgcgcggcgccgcc
acggtgttcgtggtcgaccgggtccccgagcggctggcgaaggccacggagatcggcgcc
gtccccatcgacttcagcaagggcgacccggtgccgcagatcgtggaccgcaccggcggc
gagggcaccgacaagggcatcgacgcggtgggctaccaggcccaggcgcacgacgccagc
catgaggagcccgcgtcggtgctcaactcgctggtcgacaccgtgcggccgaccggtcgg
ctcggcgtgccggggctgtacgtcccgtccgaccccggcggccccgatgagcacgccaaa
cgcggtcagctgctggtctccatcggccggatgttcgagaagggccagcgcatgggcacg
ggccagtgcaacgtcaagcgctacaaccgccagctgcgcgacatgatcatcgctgggcgc
gcccggcccagcttcgtggtctcgcacgaactgccgctggaccaggccccgcaggcgtac
gagaagttcgacaagcgggtcgagggctacaccaaagtggtgttgcatccggcgctcgct
gcctga

DBGET integrated database retrieval system