KEGG   Streptomyces rapamycinicus: M271_16430Help
Entry
M271_16430        CDS       T02907                                 

Definition
(GenBank) hypothetical protein
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
src  Streptomyces rapamycinicus
Brite
KEGG Orthology (KO) [BR:src00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    M271_16430
Enzymes [BR:src01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     M271_16430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: AGP54852
Position
complement(4229569..4230510)
Genome map
AA seq 313 aa AA seqDB search
MNLRLMSVHAHPDDESSKGAATLAKYAAEGVEVLVVTCTGGERGDVLNPAMDRPGVRENL
AAIRRDEMAEARRILGVRQHFLGFVDSGLPGPGEPLPEGCFALAPLAEAAGRLVGLMRSF
RPHVVVTYDETGGYPHPDHIRTHQVTVAAFDAAGEEAGETGEAGRRPESGAPWRPLKLYY
QGGLSRPWFQALHDAMTARGMDSGMREVLAELPGAGLEITTRVPCAEYFATRDRALLAHA
TQIDPNAGFMLHDRDVERQVWPTEDYHLARSHVGVGVGVGVDVATPEDDLFAGVRCPQGS
TAAAGAAASPGCG
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
ttgaacctgcgtctgatgagcgtgcacgcccaccccgacgacgagtccagcaagggcgcc
gccacgctggccaaatacgccgccgagggggtggaggtgctggtggtcacctgcacggga
ggggagcgtggcgatgtgctcaaccccgccatggaccgccccggtgtgcgggagaacctc
gccgcgatccggcgggacgagatggccgaggcccgccggatcctgggcgtacggcagcac
ttcctggggttcgtcgactcggggctcccggggccgggcgagccgctgcccgagggctgc
ttcgcgctcgcgccgctggcggaggcggccgggcgcctggtggggctgatgcggagcttc
cggccgcatgtggtcgtcacgtacgacgagaccggcggctatccgcacccggatcacatc
aggacccatcaggtgacggtcgccgccttcgacgcggcgggggaggaggccggggagacc
ggggaagccgggcgccgtcccgagtcgggcgcgccctggcgacccctgaagctgtactac
cagggcggtctgtcgcggccgtggttccaggcgttgcacgacgccatgaccgcgcggggc
atggactcgggcatgcgggaggtgctggccgaactgcccggggcggggctggagatcacc
acacgggtgccgtgcgcggagtacttcgcgaccagggaccgggcgctgctcgcgcatgcc
acgcagatcgacccgaacgccgggttcatgcttcacgaccgtgacgtcgagcggcaggtc
tggcccactgaggactaccacctggcccggtcccacgtcggcgtcggcgttggcgtcggc
gtcgacgtcgcgacacccgaggacgacctgttcgccggtgtgcggtgcccccagggatct
acggcggcggcaggtgccgcagcttctccgggttgcggatga

DBGET integrated database retrieval system