KEGG   Streptomyces rapamycinicus: M271_35725Help
Entry
M271_35725        CDS       T02907                                 

Definition
(GenBank) esterase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
src  Streptomyces rapamycinicus
Brite
Enzymes [BR:src01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     M271_35725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 DLH Peptidase_S9 UPF0227 Abhydrolase_5 Lipase_3 Esterase_phd BAAT_C Abhydrolase_3 Thioesterase Abhydrolase_2 DUF2117 Eno-Rase_NADH_b DUF829 Esterase AXE1
Motif
Other DBs
NCBI-ProteinID: AGP58550
UniProt: A0A0A0NUR2
Position
complement(8768243..8769064)
Genome map
AA seq 273 aa AA seqDB search
MVPLLPGAEPFRHDGGEIGVLVCHGFTGSPQSVRPWADHLAARGLTVSLPLLPGHGTRWQ
DLAVTGWQDWYAEVDRELARLSRECERVFVCGLSMGGALALRLAAQHGAAISGVAVVNPA
NRIHDPLAVALPVLRHLVPSVKGIVSDIAKPGSRESGYERMPLHAVHSMRRFYRVVDAEL
PQVTQPLLVMHSPQDHVVPPADSERILSQVSSRDVTERLLERSYHVATLDHDAEFIFEET
DTFITRLTAGMGEDTTRTGLGKGSGREGAAASG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
gtggtgccgctcctgcccggagccgagccgttccgccacgacggcggagagatcggcgtc
ctcgtctgtcacggattcaccggctccccgcagtccgtgcggccctgggccgaccatctc
gcggcccgtggtctgaccgtctcactgccgctgcttcccggccatggcacgcgctggcag
gatctcgccgtcaccggctggcaggactggtacgcggaggtggaccgcgagctggccagg
ctctcccgggagtgcgagcgggtgttcgtctgcggtctgtcgatgggcggggcgctcgcg
ctgcggctggccgcccagcacggcgcggcgatcagcggcgtggccgtcgtgaacccggcc
aaccgcatccacgatccgctggccgtggcccttccggtgctgcgtcatctggtgccgtcg
gtgaagggcatcgtgagcgacatcgccaagccagggtcgcgggagtcgggttacgagcgg
atgccgctgcacgccgtgcactcgatgcgccgcttctaccgggtggtcgacgccgaactg
ccacaggtgacccagccgctgctggtgatgcacagcccccaggaccatgtggtgccgccg
gccgactccgagcgcatcctcagtcaggtgtcctcgcgggatgtcaccgagcggctgctc
gagcgcagctaccacgtggcgacgctggaccacgacgccgagttcatcttcgaggagacg
gacacgttcatcacccggctgacggcgggtatgggtgaagacaccacccggaccggcctc
gggaagggcagcggaagggagggggcggcggccagtggctga

DBGET integrated database retrieval system