KEGG   Streptomyces rapamycinicus: M271_42250Help
Entry
M271_42250        CDS       T02907                                 

Definition
(GenBank) hypothetical protein
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
src  Streptomyces rapamycinicus
Pathway
src00260  Glycine, serine and threonine metabolism
src00330  Arginine and proline metabolism
src00340  Histidine metabolism
src00350  Tyrosine metabolism
src00360  Phenylalanine metabolism
src00380  Tryptophan metabolism
src01100  Metabolic pathways
src01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:src00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M271_42250
   00330 Arginine and proline metabolism
    M271_42250
   00340 Histidine metabolism
    M271_42250
   00350 Tyrosine metabolism
    M271_42250
   00360 Phenylalanine metabolism
    M271_42250
   00380 Tryptophan metabolism
    M271_42250
Enzymes [BR:src01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     M271_42250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 FAD_binding_3 FAD_binding_2 Pyr_redox_2 DAO AlaDh_PNT_C ApbA Pyr_redox IlvN Pyr_redox_3 Thi4 Rossmann-like HI0933_like UDPG_MGDP_dh_N DUF3945
Motif
Other DBs
NCBI-ProteinID: AGP59825
UniProt: A0A0A0NWI2
Position
complement(10468490..10470523)
Genome map
AA seq 677 aa AA seqDB search
MTDAPRDNSATRARWQTCLKLARELLLIGPDDTDLKLGYLHTLIDTGSLGVTRHPRKKIL
IIGAGITGLVAGRLLKDAGHDVTILEANTGRAGGRIKTFRTTKHHQPFDDAAQYAEAGAM
RLPDFHPLVLALVDKLGLGRRLFYNVDVDPATGSGPDVPVPPVTYTSFTGRTWTYGDDSP
DFREPDKRGNTWIRTNRVQVRRADYSAVPEKINEGFHLTDDEVRAPAVRMVDDALESVRD
YYSDVVDGKRVNKPLEEWIEGWARVIHDFDGYSMGGFLRDYAGFSDEAIEAVGTLENMSS
RLHLSFFHSFLSHTDISPGVRYWEIPGGSWRLPDALHRGLRDEVRFGHRMIRLEYFDPSR
DSAPEGTGAVGPDGWGVAVQTVAEDNPAGPTRLWTADLAIVAIPFSTLRFVEIVPSMSYK
KRRAIIETHYDSATKVLLEFSHRWWEFTEDDWREELDGITPGLYDYYQRGGTGTDPVPAL
AEAGRDLLGAAVKDSGVTEELRQVNSTMPLRGPAVRPATHCFGGGSATDNPNRFMYYPSH
PVEGSTGGVVLASYSWSDDAARWDSMREVERYVYALRNLQALHGRRIEVFFTGLGATKSW
ARDPYAFGEAATYTPHQMTSFHLDASRPEGPVHFAGEHTSLKHAWIEGALESAVRAATAV
HQAPPLTTPGPDQKGSS
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgctccacgcgataactccgccacccgtgcgcgctggcagacctgtctcaag
ctggcccgcgaactcctcctcatcggaccggacgacaccgacctcaaactcggctatctc
cacaccctcatcgacacgggcagcctcggcgtcacccgccacccccgcaagaagatcctc
atcatcggcgccggtatcaccggcctggtggccggccgcctgctcaaggacgcgggccac
gacgtcaccatcctggaggccaacaccggccgtgccggcgggcgcatcaagaccttccgc
accaccaagcaccaccagccgttcgacgacgccgcccagtacgccgaggccggcgccatg
cggctgcccgacttccatccgctcgtcctcgccctcgtcgacaaactcgggctcggccgc
cgcctgttctacaacgtggacgtcgaccccgccaccggcagcggccccgatgtccccgtc
cccccggtgacgtacacctccttcaccggccgcacctggacctacggcgacgacagcccc
gacttccgcgagcccgacaagcgcggcaacacctggatccgcaccaaccgcgtccaggtg
cggcgcgccgactacagcgccgtcccggagaagatcaacgagggtttccacctcaccgac
gacgaggtccgcgcccccgccgtgcggatggtcgacgacgcgctggagagcgtgcgggac
tactactccgacgtcgtggacggcaagcgggtcaacaagccgctcgaggagtggatcgag
ggctgggcccgggtgatccatgacttcgacggctattcgatgggcggcttcctgcgcgac
tacgcagggttcagcgacgaggccatcgaggcggtcggaacgctggagaacatgtcgtcg
cggctccatctctccttcttccacagcttcctgagccacaccgacatcagccccggtgtg
cgctactgggagatacccggcggcagctggcgactgccggacgccctccaccggggcctg
cgcgacgaggtgcggttcggtcaccgcatgatccgcctggagtacttcgaccccagccgc
gactccgcccccgagggcaccggcgctgtcggacccgacggctggggcgtggccgtgcag
accgtcgccgaggacaacccggcgggccccacccgcctgtggaccgcggacctggcgatc
gtcgccatcccgttctccaccctgcgcttcgtggagatcgtcccctcgatgtcgtacaag
aagcgccgcgccatcatcgagacccactacgactcggccaccaaggtgctgctggagttc
agccaccggtggtgggagttcaccgaggacgactggcgcgaggagctcgacggcatcaca
ccgggcctctacgactactaccagcgcggcgggaccggcaccgatcccgtgcccgcgctc
gccgaggcgggccgcgacctgctcggcgccgcggtcaaggacagcggtgtcaccgaggag
ttgcgccaggtcaacagcaccatgccactgcgcggccccgccgtgcgccccgccacccac
tgcttcggtggcggctccgccaccgacaaccccaaccggttcatgtactacccctcgcac
ccggtcgagggcagcaccggcggtgtggtgctcgcctcgtactcctggtccgacgacgcc
gcgcgctgggactccatgcgcgaggtggagcgctatgtctacgccctgcgcaacctccag
gccctgcacggacgccgcatcgaggtgttcttcaccggcctgggcgccaccaagagctgg
gcccgcgacccgtacgccttcggcgaggccgccacgtacaccccgcaccagatgaccagc
ttccacctggacgcctcccgccccgagggcccggtgcacttcgccggggagcacacctcg
ctcaagcacgcctggatcgagggcgccctggagagcgccgtccgcgccgccaccgccgtc
caccaggcaccgcccctcaccaccccgggtccggaccagaagggcagttcatga

DBGET integrated database retrieval system