KEGG   Streptomyces rapamycinicus: M271_47650Help
Entry
M271_47650        CDS       T02907                                 

Definition
(GenBank) phospholipase C
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
src  Streptomyces rapamycinicus
Pathway
src00562  Inositol phosphate metabolism
src00564  Glycerophospholipid metabolism
src00565  Ether lipid metabolism
src01100  Metabolic pathways
src01110  Biosynthesis of secondary metabolites
src02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:src00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    M271_47650
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    M271_47650
   00565 Ether lipid metabolism
    M271_47650
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    M271_47650
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:src02042]
    M271_47650
Enzymes [BR:src01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     M271_47650
Bacterial toxins [BR:src02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   M271_47650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756
Motif
Other DBs
NCBI-ProteinID: AGP60892
Position
complement(11902976..11905009)
Genome map
AA seq 677 aa AA seqDB search
MQLAGTGTAMSLLSASIARAAEIPANRRTGSLRDIEHIVVLMQENRSFDHYFGTLRGVRG
FGDPRPVRLPSGKPVWHQSDGSKEVLPFRPEVNDLGLQFLQDLPHGWGDGHVAFNDGAYD
KWVPSKSATTMAYLTREDIPFHYALADTFTICDAYHCSFIGSTDPNRYYLWSGYTGNDGK
GGGPVLDNAEAGYGWTTYPERLEQAGVSWKIYQDIGDGLDAKGGWGWIDDAYRGNYGDNS
LLYFNQYRDAKPGDPLYDKARTGTDAKNGDGFFDVLRADVKAGKLPQISWIAAPEAFSEH
PNWPANYGAWYVAQVLDALTSDPEVWSRTALLITYDENDGFFDHVVPPYAPAAERGASTV
DTTGELYAGSSAQPAGPYGLGQRVPMLVVSPWSKGGWVCSQTLDHTSVIRLMERRFGVEE
PNISPWRRAVCGDLTEAFDFSRTDVKVPALPDTSGYRPKDNERHPDYVPALPANPSLPPQ
ESGLRPARPLPYDLSADATTGADGGLRIDFVHHGKGTAAHFHVTSASHEGGPWGYTVEAG
KRLSGSWQRSSADNGAYDLQVHGPAGFLRHFTGHATGEGPEVSARHDRATGAVELTLVNQ
GDATLRLTVTDGYHQEKQADYRLRPGARVVHTARTGRSHHWYDLSVVSDHDSGYLRRLAG
HVETGRAGMSDPALSAD
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgcaacttgccggcaccggcacggccatgtccctcctctccgccagcatcgcgcgcgcc
gcggagattccggcgaaccgccggaccggaagcctgcgggacatcgagcacatcgtcgtg
ctgatgcaggagaaccgctccttcgaccactacttcggaaccctgcgcggggtacgggga
ttcggcgatccgcggccggtgcggctgcccagcggcaagccggtgtggcaccagtccgac
ggctccaaggaggtcctgccgttccgtcccgaggtgaacgacctcgggctgcagttcctc
caggacctgccgcacggctggggcgacggccatgtggcgttcaacgacggcgcgtacgac
aagtgggtgccctcgaagtcggccaccaccatggcgtatctgacccgcgaggacattccg
ttccactacgcgctggccgacaccttcaccatctgcgacgcctaccactgctcgttcatc
ggctccacggaccccaaccgctactacctgtggtccggttacaccgggaacgacggcaag
ggcggcggcccggtgctggacaacgcggaggccggctacggctggaccacctaccccgag
cgcctggaacaggccggggtctcctggaagatctaccaggacatcggcgacgggctcgac
gccaagggcggctggggctggatcgacgacgcctaccgcggcaactacggcgacaactcg
ctgctgtacttcaaccagtaccgcgacgccaagcccggcgacccgctgtacgacaaggcc
cgcaccggtaccgacgccaagaacggcgacggcttcttcgacgtcctgcgggccgatgtg
aaggccgggaagctgccgcagatctcctggatcgcggcccccgaagccttcagcgagcac
cccaactggcccgcgaactacggcgcctggtacgtcgcccaggtgctggacgcgctcacc
tccgaccccgaggtgtggagcaggaccgcgctgctcatcacctacgacgagaacgacggc
ttcttcgaccacgtggtgccgccgtacgcgcccgccgccgagcggggcgcctcgaccgtg
gacaccaccggggagttgtacgccggctcctccgcgcagcccgcgggcccgtacgggctg
gggcagcgggtgccgatgctggtggtgtcgccgtggagcaagggcggctgggtgtgctcg
cagacgctggaccacacctcggtcatccggctgatggagcggcgcttcggcgtcgaggag
ccgaacatctcgccgtggcggcgggcggtgtgcggcgacctgaccgaggccttcgacttc
tcccggaccgatgtgaaggtcccggccctgccggacaccagcggctaccggcccaaggac
aacgagcggcacccggactacgtaccggcgctcccggcgaacccctcgctgcccccgcag
gagtccgggctgcgccctgccaggccgctgccgtacgacctgtcggccgatgccacgacc
ggcgccgacggcggtctgcggatcgacttcgtgcaccacggcaagggcaccgccgcgcac
ttccacgtgacctccgcgagccatgagggcgggccgtggggctacaccgtcgaggcgggc
aagcggctgtccggcagctggcagcgctcctcggcggacaacggcgcctatgacctccag
gtgcacggtccggccggtttcctgcgccacttcaccggccacgccaccggcgagggcccc
gaggtgagcgcccgtcacgaccgggcgaccggggcggtcgagctgaccctcgtcaaccag
ggcgacgcgacgctgcggctcaccgtcaccgacggctaccaccaggagaagcaggcggac
taccggctccggccgggcgcgcgggtggtgcacaccgcccgcaccgggcgcagccaccat
tggtacgacctgtcggtggtctccgaccacgacagcggctatctgcgccggctggccggg
catgtggagaccggccgagcggggatgagcgaccccgcgctctcggcggactga

DBGET integrated database retrieval system