KEGG   Spirosoma radiotolerans: SD10_11080Help
Entry
SD10_11080        CDS       T03819                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
srd  Spirosoma radiotolerans
Pathway
srd00260  Glycine, serine and threonine metabolism
srd01100  Metabolic pathways
srd01110  Biosynthesis of secondary metabolites
srd01120  Microbial metabolism in diverse environments
srd01130  Biosynthesis of antibiotics
srd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:srd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SD10_11080
Enzymes [BR:srd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SD10_11080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_1_2 Aminotran_3 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AKD55360
UniProt: A0A0E3ZUR0
Position
complement(2728590..2729615)
Genome map
AA seq 341 aa AA seqDB search
MLIDLRSDTVTQPTPAMREAMFSAPLGDDVLGDDPTVNALEAKAAALFGMEAALFCASGT
MTNQLAIRTHTRPGDDVICDYLSHVYQYEGGGISVNALASVSLIHGQRGKITPELIREYI
YNPADAHKPISRLVVLENTVNKGGGCYYTVPEIAAIRKVCDENGLILHLDGARLFNALIE
TGEPTVAYGQLFDSISICLSKGLGCPVGSLLLGKADFIRQARRFRKLMGGGWRQAGFLAA
AGIYALDHHIDRLKQDHSRARKIGAMLERLPEVEEILPIDTNIVIFRLPETILAADYVAS
LETKGIRCITFGKHLVRFVTHLDFTDEMVAGMETILSPDFA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcttattgaccttcgtagcgataccgttacacaacccacgcccgctatgcgcgaggct
atgttttctgctcctctcggcgacgatgtgcttggcgatgacccaaccgtaaatgcgctc
gaggctaaagctgccgctttgttcgggatggaagcggcccttttctgtgcatcgggtacg
atgaccaaccaactcgccattcgtacacatactcgccccggcgatgatgttatctgcgat
tatctgtcgcacgtttaccagtatgaagggggtggtatttctgtcaatgcgctggcatcg
gttagcctgattcacggccagcgcggcaagattacccccgagctgattcgcgagtatata
tacaatccagccgatgcccacaagcctatctcccggttggtggtcctggaaaacaccgtg
aataaaggcggaggctgctactataccgttcccgaaattgcagccattcggaaagtttgc
gatgaaaacgggctgattctgcatctggatggcgccaggcttttcaacgccttgattgag
acaggtgagccgacggtggcttatgggcaacttttcgactcgatcagtatttgtttgtcg
aaagggctgggctgcccggtggggtcactcctgctcggtaaggccgattttattcggcag
gcccggcgcttccggaaactcatgggtggcggctggcgacaggccggatttctggcggct
gccggtatttacgccctcgaccaccacatcgatcgcctgaaacaggaccattcccgagcc
cgcaaaatcggggcgatgctcgaacgcttacccgaggttgaagaaatccttcccatcgac
acgaatattgtcattttccggcttcccgaaaccatattagctgccgactatgttgcttct
ttagaaacaaaagggattcgctgcatcacgtttggcaaacatttagtgcggttcgttacg
catttagattttaccgacgagatggtagcggggatggaaacaatactgagccccgatttt
gcctga

DBGET integrated database retrieval system