KEGG   Spirosoma radiotolerans: SD10_13075Help
Entry
SD10_13075        CDS       T03819                                 

Definition
(GenBank) sugar dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
srd  Spirosoma radiotolerans
Pathway
srd00030  Pentose phosphate pathway
srd01100  Metabolic pathways
srd01120  Microbial metabolism in diverse environments
srd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:srd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SD10_13075
Enzymes [BR:srd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     SD10_13075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 5_nucleotid_C
Motif
Other DBs
NCBI-ProteinID: AKD55694
UniProt: A0A0E3ZVA9
Position
complement(3224645..3225454)
Genome map
AA seq 269 aa AA seqDB search
MEQVLKGQVAIITGASSGIGAGVAKSLALAGATVVVNYPGESSKDAADAVLSELTNEGGT
GIVAQCDVTKEDQVIKLFADVVAQFGTVDILINNAGLQRDAKFDEMTLEQWNTVISVNLT
GQFLCAREAIREFLRRGPRPEVSAATGKIICMSSVHELIPWGGHVNYATSKGGVKMLMQS
LAQEYGDRRIRVNSICPGAIQTPINKSAWETPQALNSLMTLIPYNRIGQPADIGNLAVFL
ASDQSDYITGASIFIDGGMTVFEGFASNG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggagcaggtattaaaagggcaggtcgccataatcaccggagcaagtagtggcataggc
gcaggcgtagcaaaatcgctggcccttgccggggcaacggtagttgtcaattacccgggc
gagagcagtaaggatgcggccgatgccgtattaagtgagctaacaaatgagggcggtacg
ggtatcgttgctcagtgcgatgttacgaaggaagatcaggtgattaaactgtttgcggat
gttgtcgcccagtttggaacggtcgatattttgatcaataacgcgggtttacagcgggat
gcaaaatttgacgaaatgaccctggaacagtggaacactgtaattagcgttaacctgaca
gggcagttcctatgtgcccgcgaggccattcgcgaatttttgcgtcgtgggccgcgcccc
gaggtgtccgcagcaaccggaaaaatcatttgcatgagctccgtacacgaactcatcccc
tggggcggtcacgtcaattacgcgacgtcgaagggtggcgttaaaatgctgatgcaatcg
ctggcgcaggaatacggtgatcgtcggattcgggtgaacagtatttgtccaggtgcgatt
cagacgcctatcaacaagtcggcctgggaaacgccccaggcgctgaatagcctgatgacc
ctgattccatacaatcggattgggcagcctgccgacatcggtaacctggctgtttttctg
gcttcggatcaatcggactacattacgggcgccagcatctttatcgatggtggcatgacc
gtttttgaaggcttcgcatcaaatggatag

DBGET integrated database retrieval system