KEGG   Spirosoma radiotolerans: SD10_13410Help
Entry
SD10_13410        CDS       T03819                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
srd  Spirosoma radiotolerans
Pathway
srd00670  One carbon pool by folate
srd01100  Metabolic pathways
srd01120  Microbial metabolism in diverse environments
srd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:srd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SD10_13410
Enzymes [BR:srd01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     SD10_13410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AKD55749
UniProt: A0A0E3ZWJ6
Position
complement(3304168..3305127)
Genome map
AA seq 319 aa AA seqDB search
MTKITDHIKAANGKPIFSIEVIPPIKGDNLKSLLDNIEPLMEFKPPFIDVTYHREEYIER
PLPDGTIQKIVTRKRPGTVGICSAIMHRFGVDPVPHVLCGGFSREETEDFLIDLHYLGID
NALVLRGDPAKPFTTFKAKENGYMYASELVEQVANMNKGIYLHEEDTALAPSSFCIGVAA
YPEKHFEAADHDTDFQYLKQKIDKGADYIVTQMFFDNKKFIDFVDRCRKEGINVPIIPGL
KPLSTRRQLQVLPKLFHLELPADLVRAVEACENDQQARQVGIEWCIQQCRELIAYGAPVM
HFYTMGKSDNIMKVAQEIF
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattaccgatcatatcaaggctgctaacggcaaaccaattttttccattgaa
gttattccgcccattaaaggcgataatctgaaaagtctgctcgacaatatcgagccgctg
atggagtttaagccaccttttattgacgttacctaccatcgggaggagtacatcgagcgg
cccttgcccgatggaaccattcaaaaaattgtaacgcgtaaacggcccggtaccgtaggg
atttgttcagccattatgcaccgctttggcgttgatccggtgccgcatgtgctctgcggt
ggtttttcccgtgaagaaacggaggattttctgattgacctccactacctgggcatcgac
aacgccctcgttctacggggtgatccagccaagccgtttacgacctttaaggctaaggaa
aatggctacatgtatgccagcgagctggtcgagcaagtggccaatatgaacaaaggaatt
tacctgcacgaagaagatacagccctggcccccagtagcttctgcattggtgtggccgct
tacccagagaaacattttgaggctgctgaccatgacaccgatttccagtacctaaaacag
aagatagacaaaggggcggattacatcgtgacgcagatgtttttcgacaataaaaagttc
atcgactttgtcgaccgttgccggaaggaagggattaatgtgcccatcattccgggtctg
aaaccgctcagcacccgccggcaacttcaggttttacccaagctgttccacctcgaattg
ccggccgatctggtccgtgcggtggaagcctgcgagaacgatcagcaggcccggcaggtt
ggtatcgaatggtgcattcagcaatgtcgcgaactgatcgcctatggcgcacccgtgatg
cacttttacaccatgggtaagtccgataacatcatgaaagtggcgcaagagatcttctga

DBGET integrated database retrieval system