KEGG   Spirosoma radiotolerans: SD10_16270Help
Entry
SD10_16270        CDS       T03819                                 

Definition
(GenBank) phospholipase C
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
srd  Spirosoma radiotolerans
Pathway
srd00562  Inositol phosphate metabolism
srd00564  Glycerophospholipid metabolism
srd01100  Metabolic pathways
srd01110  Biosynthesis of secondary metabolites
srd02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:srd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SD10_16270
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SD10_16270
   00565 Ether lipid metabolism
    SD10_16270
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SD10_16270
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:srd02042]
    SD10_16270
Enzymes [BR:srd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     SD10_16270
Bacterial toxins [BR:srd02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   SD10_16270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 Occludin_ELL
Motif
Other DBs
NCBI-ProteinID: AKD56220
UniProt: A0A0E3ZX88
Position
complement(3998407..4000917)
Genome map
AA seq 836 aa AA seqDB search
MDSRRDFIKKAALLSTSLSGILPESIQKAFSIDPQPGTSYLDAEHVVILMQENRSFDHTY
GTLQGVRGFNDPRAIDLPNKHKVWLQTNAVGETYAPFRLNMHDTKATWMSSLPHSWENQV
DALNGGKHDKWLDAKKSGNKEYAQMPLTLGYYNREDLPFYYALADAFTVCDQNFCSSLTG
TTPNRLFFWTGTLRDPRDPKAIANVRNENVDYGSEVSWTTFPERLEENGISWKIYQNEIS
LPTGLAGEADGWLSNFTDNPIEWFSQYQVRYHPAYYRHIQQEEKAIPERIQTLETKLKSL
SESDKEYATVKRELAHQQQWQKMVQSDLVTYTPGKFSQLPEREKNLHQKAFTTNARDAHY
HELTTLTYDDGETKRQLTVPKGDVLHQFREDVANKTLPTVSWVVAPENFSDHPSAPWYGA
WYISEMLDILTQNPEVWKKTIFILAYDENDGYFDHVPPFLPAHPDHPETGLTSKHIDTRS
EFVTQEQESKRKKPGRTGPVGLGFRVPLVVVSPWSRGGYVNSEVFDHTSTLQFLENVLSH
KIGKEIREPNISTWRRTVCGDLSSVFRPYNGEAIKLPKSLAKDAFIKGIHKAQFKDVPTN
YKRLSEQDIQQCATHPTASPYLPRQEEGIRPSCALPYELYVDGQVVDKQFVLTLSAKTDV
FGKQALGAPFQVHQRQNGGVALRSYTVSAGDKLRDSWPIDQPVQLHIQGPNGFYRAFSSD
PANPLIQVVCDYERDVRKKLTGNVVVKLKNTDPVRSYTIQLLDNAYQTKKQSVTLEKAGM
AGEQQTVLLNLKNSHNWYDFSVKVAGFDTFEQRYAGRVETGKAGYSDPYMGRIRKT
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atggattccagaagagactttatcaaaaaagctgcgttgttgtcaacaagcctctcgggt
attttacccgagtcgattcaaaaagcattttctatcgatcctcagcctggtacgagttat
ctggatgccgagcacgttgtcattctgatgcaggagaatcgctccttcgatcatacgtat
gggacattgcagggcgtgcgtgggttcaatgaccccagagcgatcgacttgccgaacaaa
cacaaagtctggcttcagaccaacgcagttggcgaaacttacgctccttttcgcctgaac
atgcacgacacgaaagcgacctggatgagttcgctgccgcattcctgggagaaccaggtc
gacgctctgaacgggggtaaacacgataaatggctggatgccaaaaagtcgggcaataag
gagtacgcacaaatgccccttacgctgggctattacaaccgcgaagatttgcccttttat
tacgctctggcggatgcgtttacggtttgcgaccagaatttctgctcatcgctgacgggc
acgacacccaatcggctgtttttctggacgggcacgctccgcgatccgcgcgatccgaag
gccatcgccaatgtgcgcaacgaaaacgtggattacggttcggaagttagctggacaaca
tttccggagcgtctggaagaaaacggtatttcctggaaaatctatcagaacgaaattagt
ttgccaacggggctggcgggggaggccgatggttggttaagcaacttcaccgacaatccc
atcgaatggttttcccagtaccaggttcggtatcatccagcctattaccggcatattcag
caggaggagaaagcgattcctgaacgaatacagactctggaaaccaaattgaaaagcctc
agcgagagcgataaggagtacgcaaccgttaagcgtgaactggctcaccaacagcagtgg
cagaaaatggtccagtctgatctggtgacttatacgccgggaaaattcagtcaactgcct
gaacgggaaaagaatcttcatcaaaaagcattcacgactaatgcccgtgatgcccattac
catgaattaacaacgctgacctacgacgatggggagaccaagcggcagctaacggttccg
aaaggcgatgtgcttcaccagtttcgggaagatgtggcgaacaaaaccctaccgactgta
tcctgggttgtcgcgcctgaaaacttctccgatcacccttcggcaccctggtatggcgcc
tggtatatttcggagatgctcgacatattgacccagaatcccgaggtttggaaaaagaca
attttcattctggcctatgacgaaaacgacggctactttgaccatgtacctcctttctta
cccgcacatccagaccatcccgaaacgggcctgacgagtaaacacatcgatacccgttct
gaatttgtgacacaggagcaggaaagcaagcggaaaaaaccaggccggactggcccggtt
ggtttagggtttcgcgtgcctctggtggttgtctcgccctggagccgaggtggttatgtg
aactcagaagtgttcgaccatacctcaacgctccagtttttggaaaacgtcctgagccac
aaaataggcaaagagattcgcgagccgaacatcagtacctggcgacgtacggtctgtggc
gacctctcgtcggtgttcaggccctataacggcgaggcaatcaaattgccgaaatcattg
gcaaaagatgccttcatcaagggaattcacaaagcccagtttaaagacgttccaaccaac
tataaacgcctttctgaacaggacattcagcagtgtgccacccatccaactgcttcaccg
tatttgccgcgtcaggaagaaggcattcggccatcgtgcgcgttgccgtatgaactgtac
gtagatggccaggtggtcgataagcagtttgttttgaccttgtcggcgaaaacagacgtg
tttggcaagcaggcactcggcgcgccttttcaggttcatcaacgccaaaatggcggggtc
gcattgcgttcgtataccgtatcggctggtgacaagttgcgggattcgtggcctattgat
cagcctgttcaactgcatatacaagggccaaatggcttttatcgggcgtttagcagcgat
ccggccaatccgttgattcaggtagtatgcgattacgagcgggatgttagaaagaagcta
acgggtaatgtagttgtcaagttgaaaaatacagatccggtgcggtcatacacaatacaa
ctgctggacaatgcctaccagacaaaaaagcagtcagtaacgcttgaaaaggccggtatg
gctggcgaacagcagacggtactccttaatctgaaaaatagccacaactggtatgacttc
agcgtgaaagttgctggcttcgacacgttcgaacaacgatacgctggtcgggtagaaacc
ggtaaagcaggatactcggatccgtacatgggtcgaattcgcaagacgtag

DBGET integrated database retrieval system