KEGG   Spirosoma radiotolerans: SD10_16635Help
Entry
SD10_16635        CDS       T03819                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
srd  Spirosoma radiotolerans
Pathway
srd00770  Pantothenate and CoA biosynthesis
srd01100  Metabolic pathways
Module
srd_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:srd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SD10_16635
Enzymes [BR:srd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     SD10_16635
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     SD10_16635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein F420_oxidored adh_short_C2
Motif
Other DBs
NCBI-ProteinID: AKD56286
UniProt: A0A0E3V8G5
Position
4081838..4083061
Genome map
AA seq 407 aa AA seqDB search
MSVAGKRILLGVTGSISAYKSALLVRLLVKAGAEVQVVMTDSAQQFITPLTLATLSKRPV
LSAFVNTQSDRPGDGSWNNHVDLGLWADALVIAPASAHIIARCATGLCNDLLSAIYLSAR
CPVFFAPAMDVDMYHHRTTVDNLRRLESFGNHIIEAEYGELASGLIGEGRLAEPELILAK
LNAFWAVPSAPSGLSGKRVLITAGPTQEPIDPVRYISNHSTGKMGYAIANAFAKAGAIVT
LVSGPTSLPLPDPSIQRVDVRSAQEMFEATQMAFADADIVVLSAAVADYTPAHPADQKIK
KKETFFSLELTKTTDIAATLGTRKQPGQLMMGFALETDNERENALKKLYAKNLDWIVLNS
LRDLGAGFGHDTNKITVIDKDEQIHEFALKSKDEVAQDLVSLVKKSL
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtagcgggcaagcgaattcttttgggagttacgggtagcatttcagcctacaaa
tcggccctgctggttcggctgttggtgaaagcaggcgccgaggtacaggtcgtcatgacc
gattcagcccagcagtttataacaccccttacgctggccactctgtccaaacggcccgtg
ctatccgcgtttgtgaatacccaaagcgatcgtcctggcgatggcagctggaataatcac
gtggatctcggtctctgggccgatgcccttgtgatagcacccgcttcagctcatataata
gcccgctgtgccacagggctttgcaatgatttactatcagctatctatctgtcagcccgt
tgtccggtcttttttgcgccagccatggatgtcgacatgtatcatcatcgaactacggtt
gacaacctacgccgactcgaatcatttggcaaccacattatagaggctgagtacggcgaa
ttagccagtggattaattggggaaggccgactggctgaaccagaactcattctggcgaag
ctcaatgcgttctgggcagtgccttcagcgccgtcaggtttatccggaaagcgggtattg
atcacggcagggccaactcaggaacccattgacccggttcgatacatcagcaatcactca
acgggcaaaatgggttatgccattgctaatgcttttgccaaagcgggtgccatcgttacc
ctggtgagtgggccaacatccttgcccctccccgatccgtctattcagcgggttgatgtt
cgctcggcgcaggagatgtttgaggctacacagatggccttcgccgacgccgatattgtg
gtgttgagcgcggccgttgctgattacacgcccgcccaccccgccgatcagaaaataaag
aaaaaagaaacattcttttcactggagctgaccaagactactgatattgcggccacgctt
ggcacccgcaaacagccgggacagttgatgatgggttttgcgctggaaacagataatgaa
cgcgagaacgcattgaaaaaactttacgctaaaaacttagactggattgtattaaattca
cttcgcgatttaggagcgggctttgggcacgacaccaacaaaatcaccgttattgataaa
gacgaacaaatccatgaatttgccctaaaatcgaaggatgaagtggcacaggatttggta
agtttagttaagaaatcgctctga

DBGET integrated database retrieval system