KEGG   Salpingoeca rosetta: PTSG_00839Help
Entry
PTSG_00839        CDS       T04136                                 

Definition
(RefSeq) hypothetical protein
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
sre  Salpingoeca rosetta
Pathway
sre00071  Fatty acid degradation
sre00410  beta-Alanine metabolism
sre00592  alpha-Linolenic acid metabolism
sre00640  Propanoate metabolism
sre01040  Biosynthesis of unsaturated fatty acids
sre01100  Metabolic pathways
sre01110  Biosynthesis of secondary metabolites
sre01200  Carbon metabolism
sre01212  Fatty acid metabolism
sre04146  Peroxisome
Module
sre_M00087  beta-Oxidation
sre_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:sre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    PTSG_00839
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PTSG_00839
   00592 alpha-Linolenic acid metabolism
    PTSG_00839
   01040 Biosynthesis of unsaturated fatty acids
    PTSG_00839
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PTSG_00839
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    PTSG_00839
Enzymes [BR:sre01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     PTSG_00839
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 16078902
NCBI-ProteinID: XP_004998307
UniProt: F2TXM3
Position
Unknown
AA seq 671 aa AA seqDB search
MDGSVGVGGRGPLDEERKGAEMDVDAVMALLAGSPEVVEKRRQIRRVIEADEVMSVDDYY
FCDRTRRYERALEKTVRFVQLVRMHGWKDQDAIYARRCIREQLPVGLHWAMFIPCIKGQG
TKEQQAKWLPLAETMQIVGTYAQTELGHGTFLRGLETTATYDPATESFILNSPTLTSTKW
WPGSLGKTATHCVVMARLITKGRDYGTHAFIVQIRDLDTHRPLKGITVGDIGPKFGYDSM
DNGFLRFDSVAIPRAHLLSRYAKVAVDGSYSKPLNTKLSYGTMIFVRSHMIMDAALHLKA
ATTIAVRYGAVRRQSLMDETDTTESKILDYTVQQETLFELLGAAFAFHFAGRILSDLYHR
LQASLSSNDLSLLSYTHGTTSGLKAYCSTITSEGIEACRRCCGGHGYSKFSGLPDLYTDY
VPACTYEGENVVMYLQCARYLLKMVAAIEQKDPVPSDLAYLGDRSLAAAARKLTSTHGVK
NLDNLLLILRAIAVVRIMEAHGALISAQQRYATSGRAWNACAPVLMKAAQAHCRIMVFNY
LLEGVRAAHLDDKTHGVLVSLTRFYGLRLASYDVVETDVLTRQAIANMKQAAEDERTVIR
RNAVALVDAFDLSDFFLNSALGRADGRVYEALYEYAQKEPMNQHEVSPAVEQHLLPLMQT
TRRIFGGQSKL
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggatggcagtgttggtgtgggcggaaggggcccactggatgaggaaaggaaaggggca
gagatggatgtggatgctgtgatggctctcctcgctggatcgccagaggttgtggagaag
cgcaggcagattcgccgggtcatcgaagcagacgaagtcatgagcgtggacgactactac
ttctgtgatcgcactcgcaggtatgagcgggcgcttgaaaagaccgtgcggttcgtacag
ctggtgcgcatgcacgggtggaaggaccaggacgccatctatgctcgccgctgtatccgg
gaacagctgcctgtcgggctccactgggccatgttcattccttgcatcaaagggcaaggg
acaaaggagcagcaggccaagtggcttccgctcgcagaaaccatgcagattgtcggcaca
tatgctcagacggagcttgggcacggcacgttcctgcgcgggctggagacaacggcaacg
tacgacccggctaccgaatcgttcatcctcaacagcccgacgctgacgtcgaccaagtgg
tggccggggtcactcggcaagacagcgacgcactgcgtggtgatggcgcgactcattacc
aaaggcagggactacggcacacacgcgttcattgtgcagattcgcgatctggacacgcac
cgcccactcaagggcatcaccgtgggtgatattggaccaaagtttggctacgacagcatg
gacaatggcttcctccgcttcgattccgtggccatccctcgtgcacacctcctctcccgc
tatgcaaaggttgctgtggatggctcttactccaagcccctcaacaccaaactcagctat
gggacgatgatctttgtgcgaagtcacatgatcatggacgcagccctccacctcaaggca
gcaacaacgattgctgtgcgctacggcgccgtccgccgccagtcgctgatggacgagacg
gacacgaccgagtccaagatcctcgactacaccgtgcagcaggagacactgtttgagctg
cttggtgcggcgtttgcattccactttgcaggacgcatcctctcagacctctaccaccgt
cttcaggcgtccctctcgtccaacgatttgagtctgctgagctacacccacggcaccacc
tccggtctcaaggcctactgctcaaccatcacctctgagggcatcgaggcgtgcaggcgg
tgctgtggcggccacggctacagcaagttcagtggccttcccgatctctacacagattac
gtccctgcatgcacatacgagggcgagaatgtcgtcatgtatctgcagtgtgcgcgctat
ctcctgaagatggtcgccgccatcgagcagaaggatcccgtgccctctgatctggcctat
cttggtgatcgctcactggcagcggcagcccgcaagctcacgtcaacacacggtgtcaag
aatctggacaatcttctcctcattcttcgcgcaatcgccgtcgtccgcatcatggaggcg
cacggggcgctcatctctgcgcagcagcggtacgctacgagcgggcgcgcctggaacgcg
tgtgctcccgtcctcatgaaggctgcacaggcacactgcaggatcatggtgttcaactat
ctgctggaaggcgttcgtgctgctcacctcgatgacaagacacacggtgtgctggtgtcg
ctgacccggttctacggccttcgtctcgcttcctacgacgtcgtcgagacagatgtgctc
acgcgccaagccatcgccaacatgaagcaagcggccgaggatgagcggactgtgatccga
cgcaacgccgttgctcttgtcgatgcgtttgatctctcggactttttcctcaactccgcc
ctcggtcgcgctgacgggcgcgtgtacgaggcgctctatgaatacgcgcagaaggagccc
atgaaccagcacgaggtgtcgcccgctgttgagcagcacctgctcccgctcatgcagaca
acgcgtcgcatctttggcggacagagcaagctgtga

DBGET integrated database retrieval system