KEGG   Salpingoeca rosetta: PTSG_02154Help
Entry
PTSG_02154        CDS       T04136                                 

Definition
(RefSeq) phenylalanine hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
sre  Salpingoeca rosetta
Pathway
sre00360  Phenylalanine metabolism
sre00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sre00790  Folate biosynthesis
sre01100  Metabolic pathways
sre01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sre00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    PTSG_02154
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PTSG_02154
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PTSG_02154
Enzymes [BR:sre01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     PTSG_02154
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biopterin_H ACT
Motif
Other DBs
NCBI-GeneID: 16077229
NCBI-ProteinID: XP_004996637
UniProt: F2U1D1
Position
Unknown
AA seq 446 aa AA seqDB search
MDGGATAKRTAATDDQNGKKAKMDGEAHAMSLIFSVVSNVGALENALDIFKQHNVDLTHI
ESRPSKVSDKEYDFFITTKAKPDAIDKVVKDLQPLVARAPTVLDNDPDTTNPTWFPRKIR
ELDVFATRVLDAGRDLKSDHPGFTDAEYRKRRAFFADIAINYKHGEPIPRVEYTADEIAT
WGQVFNKLTALYPTHACAEFNRVFPLLVENCGYRADNVPQLEDISQFLKDSTGFRLRPVA
GLLSSRDFLAGLAFRVFHSTQYLRHKSKPLYTPEPDICHEILGHVPLFADKGFAEFSQEI
GLASLGASDEDVTKLATVYWFTVEFGLCRQNGELKAYGAGLLSSFGELEYCLSDKPKVHP
FEPEVTGVTEYPVTVYQPQYFVAESFASAKEKVRKFAASLKKPFTVRYNPYTESIEVLDN
TSRVRDLAVSINNDMQVLCQALAHRS
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggacggaggtgcaactgcaaagcggacggccgccactgatgaccaaaacggcaagaag
gccaaaatggatggggaggcccacgccatgtcgctcatcttctcggttgtcagcaacgtc
ggcgccctggagaacgccctcgacatcttcaagcaacacaatgtggacctgacgcacatt
gagtctcgcccctccaaggtctcggacaaggagtacgactttttcatcaccaccaaggcc
aaacctgatgccattgacaaggtcgtcaaggatctgcagccgctggtggcacgtgcaccc
acggtgctggacaatgaccccgacaccaccaacccaacctggttcccccgcaagatccgc
gagcttgatgtgtttgcgacacgtgtgctggatgctgggcgcgacctcaagtcggaccac
ccgggattcaccgacgccgaataccgcaagcgccgcgccttcttcgcagacattgccatc
aactacaagcacggcgagcccattccacgcgtggagtacaccgccgacgaaatcgccacc
tggggccaggtgttcaacaagctgacggcgctgtatcccacgcacgcatgcgccgagttc
aaccgcgtcttcccgctcctcgtcgagaactgcgggtaccgcgcagacaacgtgccgcag
ttggaggacatttcgcagtttctgaaggacagcacgggcttccggctgcggcccgtggcg
ggcctcctctcctcccgcgacttcctggccggactcgccttccgcgtgttccactccacc
cagtacctgcgccacaagtcaaagcccctctacaccccagagccagacatttgccacgaa
attcttggccacgtgcccctctttgccgacaaggggtttgcagagttctcccaggagatt
ggccttgcatcgctgggcgcctctgacgaggacgtgacaaagcttgccacggtgtactgg
ttcactgttgagtttggcctctgccgccagaacggcgagctcaaggcttacggcgccggc
ctcctctcctcctttggcgagctcgagtactgcttgtcggacaagcccaaggtgcacccg
tttgagcccgaggtgactggtgtgacagagtatcccgtcacagtgtaccagccgcagtac
tttgtcgccgaaagctttgccagtgccaaggagaaagtccgcaagtttgcggcgagcctg
aagaagccgtttactgttcgctacaacccctacacggagagcattgaggtgctggacaac
acgagccgcgtgcgcgacctcgccgtcagcatcaacaacgacatgcaggtcctctgccag
gccctcgcccatcgctcttga

DBGET integrated database retrieval system