KEGG   Salpingoeca rosetta: PTSG_03442Help
Entry
PTSG_03442        CDS       T04136                                 

Definition
(RefSeq) hypothetical protein
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
sre  Salpingoeca rosetta
Brite
KEGG Orthology (KO) [BR:sre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sre01009]
    PTSG_03442
Enzymes [BR:sre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     PTSG_03442
    3.1.3.48  protein-tyrosine-phosphatase
     PTSG_03442
Protein phosphatases and associated proteins [BR:sre01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    PTSG_03442
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese Init_tRNA_PT
Motif
Other DBs
NCBI-GeneID: 16076615
NCBI-ProteinID: XP_004996028
UniProt: F2U576
Position
Unknown
AA seq 685 aa AA seqDB search
MSRARTPPPPPAAPQATMDALSYAGNTHDAQHHPHHGIGPIACPPSQLPHLHHHAQQPIA
TSTMMDQANDALHAYANHSHFNNTSGAVNDEVAHDMLAHGMPGSTSANAVLYHGQSRHRF
SQSMLPDIPEDMPLDDELVSPRPQQQQQHQQRPFTVAGHRTRHMQYASNSTGFAHASMHA
SNMMDTDHQHGPSMHQRQLPRHHSDTMLAHGYDQQRQEQLMLQHHLHMAQHDQQQQQPDF
HSAQMLACKQQQQQQQQAHGSMFTRLDSGLDSHHEDQGFMPTPNFNTTTTTTTTTNNNNN
NNNMQHMEPHPSFPSPFSTRSSGELEDNNSSSNNNTAADDMGTEAPPRTPHHLQPCPRDQ
PDGAEYINPDTLAHLLAFQPEHVLLLDCRATLDFNLSHIRGATPVWFSRLMLKRLKRKAG
TITITDLPDAQTEALSKRHDANVLTVIYDEDCSYSMGDDNAVSMLHNMLRAEGLQPMLLR
GGFKAFRRLVDGDLVVSQHEEDTHPRAPRLQRVLQPHDLSINDSVLRIPASKIFSYLLVG
NARQGHSSEFMAEHNITHVLNVSEEPCASNVFLMVQCMQVPLMDGPGHDLLSILPQVIQF
IESARCSGGRVLIYCSNGLSRSIAILLAYMISTRKYSLTSAYRTVQTLRPLAAPHVCFLT
QLVEYEGIVRQASQHCKRRTRSADV
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgcccgcacaccgccgccgccgccagcagcaccacaggccaccatggacgcc
ctctcatacgcaggcaacacgcatgacgcccagcaccacccgcatcacggcatcggcccc
attgcatgcccgccgagccagctgccgcacctccaccaccatgcacagcagcccatcgcc
accagcacaatgatggaccaggcaaacgacgcgttgcacgcgtacgccaaccacagccac
ttcaacaacaccagcggtgccgtgaacgatgaggtggcacacgacatgcttgcacacggc
atgccaggctccacctccgccaacgccgtgctctaccacggccaatcacgccaccgcttc
agccagagcatgctgcctgatatccccgaggacatgcctcttgatgatgagctggtatca
ccccgccctcaacagcaacagcagcaccagcagcggccattcaccgtcgcaggccaccgc
acgcggcacatgcagtacgcaagcaacagcaccggctttgcgcatgcttccatgcatgca
agcaacatgatggacaccgatcaccaacacgggcccagcatgcatcagcgccagctcccg
cgccaccacagcgacacaatgcttgcgcacggctacgatcagcagcgccaggagcagctc
atgctgcagcaccacctgcacatggcacaacacgaccagcagcagcagcagcctgatttt
cacagcgcacaaatgcttgcatgcaagcagcagcagcagcagcagcaacaggcccacggc
agcatgttcacgcgtctcgacagcgggctcgattcccaccacgaggaccaaggcttcatg
ccaacgccaaacttcaacactaccaccaccaccaccaccaccaccaacaacaacaacaac
aacaacaacatgcagcacatggagccacacccgtcgtttccaagcccgttttcaactcgc
tcctctggcgagttggaggacaacaacagcagcagcaacaacaacaccgctgcggacgat
atgggcacagaggcgccaccacgaaccccgcaccatctccagccgtgccctcgtgaccag
ccagacggcgcagagtacatcaacccagacacgctggcgcacctgcttgccttccagccg
gagcacgtgctgctgctggactgtcgcgccacgctcgacttcaacctctcgcacatccgc
ggcgccactcccgtgtggttctcgcggctcatgctgaagcgcctcaagcgcaaggcaggc
accatcaccatcacagaccttccagatgcacagacggaagcgctgtcgaagcgccacgac
gcaaacgtgctcacggtcatctacgacgaagactgctcgtactccatgggagatgacaac
gccgtgagcatgctgcacaacatgctgcgggcagaggggctgcagcccatgctgctgcgt
ggcggcttcaaggccttccgtcgcctggtggacggtgacttggttgtctcgcagcacgag
gaggacacgcacccgcgcgcaccgcgcctgcaacgcgtgctccagccgcatgacctctcc
atcaacgactctgtgctgcgcatccccgcctccaagatcttcagctacctcttggtcggc
aacgcacgccagggccacagcagcgagtttatggccgagcacaacatcacgcatgtgctc
aacgtgagcgaggagccgtgcgcgagcaacgtgttcctgatggtgcagtgcatgcaagtg
ccattgatggacgggcctggccacgacctgctgtccatcctgccacaggtcattcagttc
attgagtctgcccggtgcagtggcggccgcgtcctgatctactgcagcaacggcctctcc
cgctccatcgccatcctccttgcgtacatgatctccactcgcaagtactcgctcacctcg
gcctaccgcacggtgcagacgctgcgcccgctcgccgccccgcacgtgtgcttcctcacg
cagcttgttgagtacgaagggattgtgcgccaggcgtcacagcactgcaagcgccgcaca
cgctcagccgatgtctga

DBGET integrated database retrieval system