KEGG   Salpingoeca rosetta: PTSG_03754Help
Entry
PTSG_03754        CDS       T04136                                 

Definition
(RefSeq) Hsc70-4
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
sre  Salpingoeca rosetta
Pathway
sre03040  Spliceosome
sre04141  Protein processing in endoplasmic reticulum
sre04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:sre00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    PTSG_03754
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PTSG_03754
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    PTSG_03754
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sre01009]
    PTSG_03754
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sre03041]
    PTSG_03754
   03009 Ribosome biogenesis [BR:sre03009]
    PTSG_03754
   03110 Chaperones and folding catalysts [BR:sre03110]
    PTSG_03754
   04131 Membrane trafficking [BR:sre04131]
    PTSG_03754
   03051 Proteasome [BR:sre03051]
    PTSG_03754
   03029 Mitochondrial biogenesis [BR:sre03029]
    PTSG_03754
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sre04147]
    PTSG_03754
Protein phosphatases and associated proteins [BR:sre01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     PTSG_03754
Spliceosome [BR:sre03041]
 Complex B
  Other components
   Prp19 complex
    PTSG_03754
 Complex C
   Prp19-CDC5 complex
    PTSG_03754
Ribosome biogenesis [BR:sre03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    PTSG_03754
Chaperones and folding catalysts [BR:sre03110]
 Heat shock proteins
  HSP70 / DNAK
   PTSG_03754
Membrane trafficking [BR:sre04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    PTSG_03754
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    PTSG_03754
Proteasome [BR:sre03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    PTSG_03754
Mitochondrial biogenesis [BR:sre03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    PTSG_03754
Exosome [BR:sre04147]
 Exosomal proteins
  Proteins found in most exosomes
   PTSG_03754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Radial_spoke_3 FGGY_C
Motif
Other DBs
NCBI-GeneID: 16076060
NCBI-ProteinID: XP_004995479
UniProt: F2U6H4
Position
Unknown
AA seq 581 aa AA seqDB search
MPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP
SNTVFDAKRLIGRKFNETAVQSDMKHWPFTVVEVDGRPKIQVEYMGETKQFFPEEISSMV
LVKMREIAEAYLGSEVKDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAY
GLDKKGQAEAHVLIFDLGGGTFDVSVLSIDDGIFEVKSTAGDTHLGGEDFDNRMVNHFDL
CADLFRGTLDPVEKALRDAKLGKGEIDEVVLVGGSTRIPKIQKLLQDFFNGKDLNKSINP
DEAVAYGAAVQAAILSGDKSEEVQDLLLLDVAPLSLGLETAGGVMTSLIKRNTTIPTKTS
QTFTTYSDNQPGVLIQVYEGERSMTKDNNLLGKFELSGIAPAPRGVPQIEVTFDIDANGI
LNVSAQDKASGKSNKITITNDKGRLSKDDIERMVQEAEKYKAQDEAMKEKVNAKNGLESY
AFNLKSTVDDEKFKDKISDDDKNTIKAKCDEVLAWLDSNPSAEKDEIDHQQKELEGVANP
IMSKLYAEGGVPGGMPGGMPNQGGPAPSTDETTGPTIDEVD
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgccagccatcggaattgatctgggcacgacgtactcgtgcgtcggcgtgttccagcac
ggcaaggttgagattatcgccaacgaccagggcaaccgcaccacgcccagctatgttgcc
ttcacggactctgagcgcctgattggcgacccggccaagaaccaggtggccatgaaccca
agcaacaccgtcttcgacgccaagcgcctcatcggccgcaagttcaacgagaccgccgtg
cagagcgacatgaagcactggcccttcaccgtcgtcgaggtcgacggccgccccaagatc
caggtcgagtacatgggcgagacaaagcagttcttccccgaggagatctcctccatggtc
ctcgtcaagatgagggagattgccgaggcctacctcggctccgaggtcaaggacgccgtc
gtcaccgtccccgcctacttcaacgactcccagcgccaggccaccaaggacgcaggcacc
attgccggcctcaacgtcctccgcatcatcaacgagcccacggccgccgccatcgcctac
ggcctcgacaagaagggccaggctgaggcccacgtcctcatcttcgatctcggtggtggc
accttcgatgtgtccgtcctgtccatcgacgacggcatcttcgaggtcaagtccactgcc
ggtgacacccaccttggcggcgaggactttgacaaccgcatggtcaaccactttgacctg
tgcgccgacctcttccgcggcaccctcgaccccgtcgagaaggctctgcgcgacgccaag
ctcggcaagggcgagattgacgaggtcgtcctcgttggcggctccacccgcatccccaag
atccagaagctgctgcaggacttcttcaacggcaaggacctgaacaagagcatcaacccc
gacgaggccgtcgcctacggtgccgccgtccaggccgccatcctctccggcgacaagtcc
gaggaggtgcaggacctcctcctgctcgatgtcgccccgctctcccttggtctggagacg
gccggcggtgtcatgacgtcgctcatcaagcgcaacaccaccatccccaccaagacctcc
cagaccttcaccacctactccgacaaccagcccggtgtgctgatccaggtgtacgagggc
gagcgctccatgaccaaggacaacaacctcctcggcaagtttgagctgtccggtattgcc
cccgccccacgcggtgtgccccagattgaggtcaccttcgacattgacgccaacggcatc
ctgaacgtgtctgcgcaggacaaggcctctggcaagtcgaacaagatcaccatcaccaac
gacaagggccgcctgtccaaggacgacattgagcgcatggtgcaggaggccgagaagtac
aaggcccaggatgaggccatgaaggagaaggtcaacgccaagaacggcctcgagtcttac
gccttcaacctcaagtccaccgtcgacgacgagaagttcaaggacaagatcagcgacgac
gacaagaacaccatcaaggccaagtgcgacgaggtcctcgcctggctcgactccaacccg
tctgcggagaaggacgagattgaccaccagcagaaggagctcgagggcgttgccaacccc
atcatgagcaagctgtatgccgagggtggcgtgcccggcggtatgcccggtggcatgccc
aaccagggtggccccgccccgtccaccgacgagacgactggccccaccatcgacgaggtc
gactaa

DBGET integrated database retrieval system