KEGG   Salpingoeca rosetta: PTSG_04394Help
Entry
PTSG_04394        CDS       T04136                                 

Definition
(RefSeq) hypothetical protein
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
sre  Salpingoeca rosetta
Pathway
sre00230  Purine metabolism
sre00240  Pyrimidine metabolism
sre00760  Nicotinate and nicotinamide metabolism
sre01100  Metabolic pathways
sre01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sre00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PTSG_04394
   00240 Pyrimidine metabolism
    PTSG_04394
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PTSG_04394
Enzymes [BR:sre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     PTSG_04394
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 5_nucleotid_C Metallophos
Motif
Other DBs
NCBI-GeneID: 16075068
NCBI-ProteinID: XP_004994485
UniProt: F2U8F4
Position
Unknown
AA seq 623 aa AA seqDB search
MFPNTIILQQKTLCWLACLLACLLARLNTPPSQQHTMTRKASVTPLRFIHFNDVERVHEA
KTEPVGGIARFITAINKYEDTTVLFSGDAFNPSILSSATKGHHMVPCLNAAKIEVACYGN
HDFDFGEEELKKLSQECTFPWVMTNLTDSQGVPTGTAKKKHVFEKQGVRIGVMGLAEKDW
IDTLSDPPEDIQYRDFIETAQEYIKILREEDECDLVIALTHMRENNDLALAKACPEIDLV
LGGHDHFYRVTQLDNNIVIKSGMDFKNFSVIEVTLNGDARPSVAVERVDVTSEVEPDSDM
AAYVKEADEKYATIFDKVVGYTEVEWNVHNSSVRTEENAFGNLVAGLLRARYGADLCILA
GGSFRSDRVYPAGPVTARVVSTIFPFTDACVVLEVTGKTVWAALENGVSKYPQHEGRFPQ
VSGLRMTFDPSLPPGSRLVEVTVGEDREPLDVDKTYTLATRGYMADGHDGYTALKGSKII
VDPENGSLLSTIVVQALTKVEVIKAWKRKHMILRSAIAAFRGVRPFRPKKKEEQPKALPE
SLCGAAAKDPSCIVVRPQLDGRICIVGVTPPPLQGSPPRAHKAKRAHEPTRGQDQDGTAD
DGDACNDGDDEEAAAKLPKTAIA
NT seq 1873 nt NT seq  +upstreamnt  +downstreamnt
catgtttcccaatacgatcattctccagcagaagactctttgctggcttgcttgcttgct
tgcttgcctgctcgctcgcctcaacacgcctccttcccaacaacacaccatgacgcggaa
ggcgtcagtgacgccgctgcggttcatccacttcaacgatgtggagcgtgtccacgaagc
aaagacggagcctgtgggagggattgcccgcttcatcacagccatcaacaagtatgagga
caccaccgtcctcttcagcggcgatgcgttcaacccctccatcttgagcagcgcgacaaa
gggccaccatatggtgccatgcctcaacgccgccaagatcgaggtggcatgttacggcaa
ccacgactttgactttggggaagaggaactcaagaagctgtcgcaagagtgcacctttcc
ttgggtcatgaccaacctgactgactcacagggcgtccccacgggcacggcgaagaagaa
gcacgtcttcgaaaagcagggcgtgcgcattggcgtcatgggcctcgcagagaaggactg
gatcgacacgctgagcgatcccccagaggacatccagtaccgtgacttcatcgagacggc
acaagagtacatcaagattcttcgtgaggaggacgagtgcgatctggtgattgcactgac
acacatgcgcgagaacaacgacctggccctcgcaaaggcctgccctgagattgaccttgt
gctgggtgggcacgaccatttttaccgcgttactcagctcgacaacaacatcgtcatcaa
atccggcatggactttaagaacttctccgttattgaggtgacgctgaacggcgacgccag
gccaagcgtggctgtggagcgcgtcgatgtgacgagcgaagtcgagccggactcggatat
ggctgcatatgtgaaggaggcggatgagaagtacgcaaccatcttcgacaaggttgttgg
gtacacagaggtcgagtggaatgttcacaacagttccgtcagaacagaggaaaacgcgtt
tggcaaccttgtggccgggctgctgcgtgcacgttatggtgcagacctgtgcatccttgc
tggcggctccttccgctcagaccgcgtgtatcctgctggccccgtcaccgctcgcgttgt
cagcaccatcttccccttcacagacgcgtgtgttgttctggaggttacaggcaagaccgt
gtgggcggcgcttgagaatggcgtgagcaagtatcctcagcacgagggccgcttcccgca
ggtgagcgggctgcgcatgacgtttgacccgtcgctgccgcccggctcgcgattggtgga
ggtcaccgtcggcgaggaccgcgagcccttggacgtggacaagacgtacacgctcgccac
ccgtgggtacatggccgacggccacgacggctacacggcgctcaagggcagcaagatcat
tgttgatcccgagaatggctcgcttctctccacgattgtcgtgcaggccctcaccaaggt
ggaggtgatcaaggcgtggaagagaaagcacatgattctgcgcagtgccattgccgcctt
ccgtggcgtgcgccccttcaggccaaagaagaaggaagagcagccgaaagccctgccaga
gtccctgtgtggcgctgcggcaaaggacccgtcgtgcattgttgtgcggccgcagctgga
tggccgcatctgtattgtgggggtcacgccgccgcccttgcagggcagcccgccacgcgc
gcacaaggccaagcgcgcgcacgagccaacaagaggacaggaccaggacggcactgccga
cgacggtgacgcctgtaatgatggcgatgacgaggaggctgcagcaaagcttccaaagac
ggccatcgcctga

DBGET integrated database retrieval system