KEGG   Salpingoeca rosetta: PTSG_04805Help
Entry
PTSG_04805        CDS       T04136                                 

Definition
(RefSeq) hypothetical protein
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
sre  Salpingoeca rosetta
Brite
KEGG Orthology (KO) [BR:sre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sre03019]
    PTSG_04805
Enzymes [BR:sre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     PTSG_04805
Messenger RNA biogenesis [BR:sre03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     PTSG_04805
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70 API5
Motif
Other DBs
NCBI-GeneID: 16074700
NCBI-ProteinID: XP_004994122
UniProt: F2U9R4
Position
Unknown
AA seq 593 aa AA seqDB search
MVVEEDDGGRGVKGAPSARGACRAGLTPAEEAMVAWLDQLSKRVEQRQELLQRLMAPSDR
LDDEDNNGSVDASSALATSLFLEQNDTGAHADEEVASSALALHADQEQLPGRHVLSFRAA
ATELADVDGEPGETVGEEENPSATAADGVDTGQKVEQLLQDLMSSGEEDNEDLDDGDEDK
QGDRDDDVDVAHAEGDENEAEDQHNQLQGYRGSRMFMKGKTGNTPQNDYSQHFVDTKQRP
QNFIRDADPLTRYRCYPRLDTLSRLKDDLLRARSTPPMSIRADPLCLDASSLGTSFGVIY
IDAPLPEYARRAPGLKLDTVSWEELGRLDVRGLAGEIAFVFMWVGCSEGLEKGAQLLRRW
GFRRCEDICWVKTNKQQPRRRGIMEPHSLLQHTKEHCLLGIRGAPNRKTEPHILHSNMDV
DVIVSEDPPIESTEKPSEIFAVMERMCQSRKRLHLFASGTVRPGWVGVGKDLPQTDYDAE
AYLKYMEGTIQPTIQDRPVADSGQSNEYVGTWEKIECLRPKSPPRHMSKKNKRGRGFSSS
SSSTRGRGRGRGRGRGRGMSRGGRGGRGMGPGRRGGLHGSPHTFTPPKSQWEV
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggtggttgaggaggatgatggtggccgcggggtgaagggagcaccgagtgcacgtggt
gcatgtcgtgctgggctgacgccagctgaagaagccatggttgcgtggctggaccagctc
tccaagcgcgttgagcagcgccaagagcttttacaacgcctgatggcacccagcgaccgc
ttggatgacgaggataacaatggctctgtagatgcaagttcagcgttggccacgagcttg
tttttggagcagaacgacacgggggcccatgcagacgaggaggtggcatctagcgcgctg
gcactgcacgctgaccaagagcagttgccgggccgccacgtcctcagcttcagggccgct
gcaactgagcttgcagatgttgacggcgaacctggtgagaccgtaggggaggaggagaac
ccaagtgcaacagctgctgacggtgtagatacggggcagaaggttgagcagctcctgcag
gacttgatgtcatctggtgaagaggacaatgaagatctagacgatggcgacgaagataag
cagggagacagggacgatgacgtggatgtcgcacatgctgaaggcgacgagaatgaagca
gaggaccaacacaatcaactccagggctatcgcggatcgcgcatgttcatgaaggggaag
acgggcaacacaccgcagaacgattacagccagcactttgttgatacgaaacagcgaccg
cagaacttcatccgtgatgcagatccactcacgcgctaccgttgctatccacgactggac
accctcagccgcctcaaggatgatctgcttcgcgcccgcagcacaccgccaatgagcatc
cgtgctgatccgctgtgtcttgatgcgtcttctctcggcacgtcgtttggcgtcatctac
atcgacgcgccactaccggagtatgcgcgaagggcgcccggcctcaaactggacaccgtg
tcctgggaggagcttggacggttggatgtgcgcgggctggcgggggagattgcgtttgtg
ttcatgtgggttggctgctcggagggactcgagaaaggcgcgcagctgctgcggcgatgg
gggtttcgtcggtgtgaggacatatgttgggtgaagacgaacaaacagcagccgaggcgg
cgtgggattatggagccgcacagccttctccaacacacaaaggagcactgcctgcttggc
atccgcggagctccaaaccggaagacagagccgcacatcctgcactccaacatggacgtg
gatgtcattgtgtctgaggatccgcccatcgaatcaacagagaagccgtcggagatcttt
gctgtgatggagcgcatgtgtcaatcgaggaagcggcttcatctctttgcatcgggcacc
gtccgaccagggtgggtcggtgttggcaaggacctgccccagaccgattatgatgcagag
gcatacctgaagtacatggaaggcacaattcagccgacaattcaagatcggcccgttgca
gatagcgggcagtcaaacgaatatgtgggcacgtgggagaagattgaatgcctgcgccca
aagtcgccccctcgccacatgtccaagaaaaacaaacggggcaggggcttcagcagcagc
agcagcagcactcgtggtcgtggtcgtggccgtggccgtggccgtggtcgaggcatgagt
cgtggtggtcgtggtggtcgcggtatgggacctggaaggcgtggaggcttgcacggctcg
ccgcatactttcactccaccaaagtcgcagtgggaagtttga

DBGET integrated database retrieval system