KEGG   Salpingoeca rosetta: PTSG_07429Help
Entry
PTSG_07429        CDS       T04136                                 

Definition
(RefSeq) MAP kinase
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
sre  Salpingoeca rosetta
Pathway
sre04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:sre00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    PTSG_07429
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sre01001]
    PTSG_07429
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sre03036]
    PTSG_07429
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sre04147]
    PTSG_07429
Enzymes [BR:sre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PTSG_07429
Protein kinases [BR:sre01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   PTSG_07429
Chromosome and associated proteins [BR:sre03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     PTSG_07429
Exosome [BR:sre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PTSG_07429
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 16071493
NCBI-ProteinID: XP_004990930
UniProt: F2UIP2
Position
Unknown
AA seq 212 aa AA seqDB search
MMEAQPMMTGEEQQQQQQQQQHPHHDQQHLHAHSDSIIPRGVGAPHQDPIIKGEPFRAGP
RYANIRFIGEGAYGVVCSAVDLATQEQVAIKKICPFEHQTYCQRTLREIKILTRFKHENV
RNTCACCVLCSCALDLLEKMLIFNPDKRITVEMALSHPYFEQYYDPSDEPEAEEPFTFEC
DVDDIGKEALKELIFQEVQASRAREAQELAAM
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgatggaagcacagcccatgatgacaggagaggagcaacagcagcagcagcagcagcag
cagcacccgcatcacgaccagcagcacttgcacgcccactccgacagcatcatcccgcgc
ggtgtcggcgcaccgcaccaggaccccatcatcaagggggagccgtttcgcgcgggcccg
cgctacgccaacatccgcttcattggcgagggcgcatatggggtggtgtgctcggccgtg
gacctcgccacccaagagcaggtggccatcaagaagatttgcccctttgagcaccagaca
tactgccagcgcacgctcagggaaatcaagatcctcacccgcttcaagcacgagaacgta
cgcaacacatgcgcgtgttgtgttctatgctcgtgtgcactggacctgcttgagaagatg
ctcatcttcaacccggacaagcgcatcactgtggagatggccctgtcccacccgtacttt
gagcagtactatgacccctccgacgagccagaggcagaggagcccttcacattcgagtgt
gacgtcgacgacattggcaaggaggccctcaaagagctcatctttcaagaggtgcaggca
tctcgcgcccgcgaagcacaagaacttgcagcaatgtga

DBGET integrated database retrieval system