KEGG   Salpingoeca rosetta: PTSG_08179Help
Entry
PTSG_08179        CDS       T04136                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sre  Salpingoeca rosetta
Pathway
sre00480  Glutathione metabolism
sre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sre00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PTSG_08179
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sre02000]
    PTSG_08179
Enzymes [BR:sre01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PTSG_08179
Transporters [BR:sre02000]
 Other transporters
  Pores ion channels [TC:1]
   PTSG_08179
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2 GST_C_6 GST_N_3
Motif
Other DBs
NCBI-GeneID: 16071765
NCBI-ProteinID: XP_004991204
UniProt: F2UI83
Position
Unknown
AA seq 236 aa AA seqDB search
MEPEPASKREKAEAAMPVLHYFAGRGMANPLRFVLALAGITWQENALRERQQMLDLIASG
HLAPFEQVPMLEIDGKYLTQSFATIKYIAATRSLYGKENPSVDDVYHVDTLADGARDFYV
KFVPLPFNPTPETYIEEVLKKKVITKYLPIFNNLLKASKFLAGNQPTYADAVLLTAVEFA
LDVFGADVLDDYPHLAKWKEAAWALPGMAMFKGSANHFGMPDKQYALEVDTALGRR
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggagccagagccagcgagcaagcgcgagaaggcagaagcggccatgccagtgctgcat
tattttgcagggcggggtatggcgaacccgcttcgcttcgttctcgccttggcgggcatc
acctggcaagagaatgcgctgagggagcggcagcagatgctggacctgattgcctcgggc
cacctcgccccctttgagcaggtgcccatgcttgagattgatggcaagtacctcactcag
tccttcgccacgatcaaatacattgcagcgacacgcagcttgtacggcaaggagaatcca
tccgtcgatgacgtgtaccacgtggacacgcttgcagacggggcgcgtgacttttatgtc
aagtttgtgccgctgccgttcaatccaacgccagagacatacattgaagaagtgctcaag
aagaaggtcatcaccaaataccttcccatcttcaacaacctcctcaaggcttccaagttc
cttgcaggcaaccaacccacgtatgcggatgcagtgctgctgacggcagttgagtttgcg
ctcgatgtctttggcgccgatgtgctcgacgactacccgcacctcgcaaagtggaaggag
gcggcgtgggcgctgcctggcatggccatgttcaagggctctgcaaaccactttgggatg
ccagacaagcagtacgcgcttgaggtggacaccgccctcggccgccgctga

DBGET integrated database retrieval system