KEGG   Salpingoeca rosetta: PTSG_08905Help
Entry
PTSG_08905        CDS       T04136                                 

Definition
(RefSeq) nucleolar protein 5
  KO
K14565  nucleolar protein 58
Organism
sre  Salpingoeca rosetta
Pathway
sre03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:sre00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    PTSG_08905
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sre03009]
    PTSG_08905
Ribosome biogenesis [BR:sre03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    PTSG_08905
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT DUF3326
Motif
Other DBs
NCBI-GeneID: 16070844
NCBI-ProteinID: XP_004990291
UniProt: F2UL16
Position
Unknown
AA seq 516 aa AA seqDB search
MLVLFETPAGYALFKVKKSGLMEADGKDVASQFATAESANDAVKLKAFRKFTSMPDALAA
ATALTEGKLSDGLTEFLQNSIVQKKLKDELAVYDSKLGKVIKKELNIPCIHSPAVSELMR
GIRTQLNALIKDLQEGDMKAMSLGLAHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELN
TYVMRVREWYGWHFPELSKLIADHKAFVRTIITAGNRKNFASTDFSEILPEEIEADVKEA
AEISMGTEIADEDLDHIKYLAEQVLAIAEYRAQLYDYLKNRMNVIAPNLTLMVGELVGAR
LIAHAGSLLNLAKYPASTVQILGAEKALFRALKTKHDTPKYGHLYHASVVGQSSGKNKGK
MSRVLAAKTSLVARIDALAEDSKQDYAMEYRAKVDARLRQLEGGRVYKLSKAGVSVGPSS
YELNTPVKGYNDAADSTLGATENGEKSAKKDKKKSKEDGDDKKDKKKKKKEKKEKKDKGE
KKKKDKGKRSAEDADADGEESPKKKKKSKKKAKLSE
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtgctgttcgagacaccggcagggtatgccctgttcaaggtgaagaagagcggc
cttatggaggccgatggcaaggatgttgcgtcccagtttgccaccgcagagtctgccaac
gacgccgtcaaactcaaggccttccgcaagttcaccagcatgccggatgcgcttgccgcc
gccacagcactcacagagggaaagctctccgacggcctcacagagttcctgcagaacagc
attgtccagaagaagctcaaggacgagcttgccgtgtacgactccaagctcggcaaggtc
atcaagaaggagctcaacatcccctgcatccactcgcccgccgtctccgagctcatgcgc
ggcatccgcacacagctcaacgccctcatcaaggatttgcaagagggagacatgaaggcc
atgtcccttggtcttgcacactccctctcgcgctacaagctcaagttcagcccagacaaa
gtggacacaatgatcgtgcaggccattgcactccttgacgatttggacaaggagctcaac
acatatgtcatgcgcgtgcgcgagtggtacggctggcatttccccgagctcagcaaattg
attgcggaccacaaggcgtttgtgcgcacgatcatcacggcgggcaaccgcaagaacttt
gcatcgacagacttctccgagattctcccggaggagattgaggccgacgtgaaggaggcc
gccgagatcagcatgggcacagagattgcggacgaggatctcgatcacatcaagtacctg
gcggagcaagtgctggcaattgcagaataccgcgcacagctctacgactacctcaagaac
agaatgaacgtgattgcgcccaacctgacgctgatggttggcgagcttgttggcgcacgc
ctcattgcccacgcgggctccctcctcaacctggccaagtaccccgcctccactgtgcag
attctcggtgctgagaaggcactcttccgcgcgctgaagacgaagcacgacactccaaag
tacgggcacctgtaccacgcctcggtcgtcggccagagcagcggcaagaacaagggcaag
atgtcccgcgtccttgctgcgaaaacctcccttgtggcacgtattgatgcgcttgcggag
gactcgaagcaggactatgcaatggagtaccgggccaaggtcgatgcgcgcttgaggcag
ctcgagggcggtcgcgtgtacaagctctcaaaggccggcgtctccgttggcccctcgtca
tacgaactcaacacaccagtcaagggctacaacgacgctgctgactcgacgctcggcgca
acagagaatggcgaaaagtcggccaagaaggacaagaagaagagcaaggaggatggggat
gataagaaggataagaagaagaagaagaaggagaagaaggagaagaaggacaagggcgag
aagaagaagaaggacaagggcaagcggtctgctgaggatgctgatgcggacggtgaggag
tcgcccaagaagaagaagaagtcgaagaagaaggcaaagctgtccgagtaa

DBGET integrated database retrieval system