KEGG   Salpingoeca rosetta: PTSG_09901Help
Entry
PTSG_09901        CDS       T04136                                 

Definition
(RefSeq) hypothetical protein
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
sre  Salpingoeca rosetta
Pathway
sre00510  N-Glycan biosynthesis
sre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    PTSG_09901
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sre01003]
    PTSG_09901
Enzymes [BR:sre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     PTSG_09901
Glycosyltransferases [BR:sre01003]
 Glycan extension
  N-Glycan
   PTSG_09901
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2
Motif
Other DBs
NCBI-GeneID: 16069799
NCBI-ProteinID: XP_004989255
UniProt: F2UNG5
Position
Unknown
AA seq 442 aa AA seqDB search
MVLRWRRGLLTLMLALCVLIAVASVAMLGLSAFHRANLRAEAASMHAERVLRSVRSAVHR
RGHRRHQPQPTTPGVGDHVRLYHGQWQGQALFDRLLARRVDTDKALLQQGMSTTDVAAAG
DEGPRIRTVEQGQKQQAAPRQEDERDTAFVVFILASNKDIHFEALVDSLLRCNMANGTHI
VVSHDGHDSRMERTARRLRRRFRVSQIFHPFACRTAEERHGFPKYSQFGRVRQYWQYTCA
KHHWFWAMHRVWHYFRGARWLYYLEEDFLVSKHIGSILPALMKEADARDDVFGAMSQCRD
NLWTVSGLMKRAAWDALLQRAQFFCTFDEYNWDLTMKQAFVQLDGPTRYLCPLREHVFHT
GIYGKGLTHGSEMESREELRATVDGARLRFYAKTDTWTSLAGTREEHLHTPHAGLRGFGV
EDATHCLYVHQWFQDRATKRTA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgcgatggcgacggggactgctgacgttgatgctggcgttgtgtgtgctgatt
gcggtggcatctgtggccatgttggggttgagcgccttccaccgcgcaaacttgcgtgct
gaagccgcaagcatgcatgcagaacgggtgctgcggtcggtgcgctcggccgtccatcgc
agaggacaccgtcgccaccaaccacaacccacgacaccgggggttggagaccacgtgcgc
ctgtaccacggacagtggcaaggacaggcattgttcgatcgcctgctggcaagacgggtg
gacacggacaaggcgctgctgcagcagggcatgtcaactactgatgtcgctgctgccggc
gatgagggcccaaggattcgcacggtggaacaagggcagaaacaacaagcggcgccgcga
caggaagatgagcgagacacggcgtttgtggtgttcatcctggcttcaaacaaggatatt
cactttgaagcgctggtggacagcttgcttcgctgtaacatggcaaacggcacgcacatt
gtggtctcccatgacgggcatgactcccggatggagcgcacggcgcgcaggctgcgacgc
cgcttcagggtatcccagatctttcacccatttgcctgccgcactgcagaggaacggcat
gggttccccaagtacagccagtttggccgcgtgcgccagtactggcagtacacgtgcgcc
aagcaccactggttctgggccatgcaccgcgtctggcactactttcgcggggcacgctgg
ctgtactacctcgaagaggatttcctcgtcagcaagcacattggctccatcttgcctgcg
ctcatgaaggaggcagatgccagggacgacgtgtttggtgcaatgtcccagtgccgagac
aacctgtggactgtcagcgggctcatgaaacgggcagcgtgggatgcactcctgcaacgc
gcgcagttcttctgtacttttgacgagtacaactgggacctgacgatgaagcaggcattt
gtgcagctggatggcccgacgagatacctgtgtccgctgcgcgaacacgttttccacact
ggcatctacggcaagggcctgacgcacggctcggagatggagtcacgcgaggagctgcgt
gccactgtggatggcgcccgcctccgcttctatgcaaagacagacacatggacgtcgttg
gcaggcacaagggaggagcacctgcacacaccccatgccgggctgcgcgggtttggcgtt
gaagacgcaacacactgtttatatgttcaccagtggttccaagaccgcgccactaaacgt
actgcctga

DBGET integrated database retrieval system