KEGG   Salpingoeca rosetta: PTSG_10288Help
Entry
PTSG_10288        CDS       T04136                                 

Definition
(RefSeq) hypothetical protein
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
sre  Salpingoeca rosetta
Brite
KEGG Orthology (KO) [BR:sre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sre01002]
    PTSG_10288
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sre03110]
    PTSG_10288
Enzymes [BR:sre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     PTSG_10288
Peptidases and inhibitors [BR:sre01002]
 Serine peptidases
  Family S8: subtilisin family
   PTSG_10288
Chaperones and folding catalysts [BR:sre03110]
 Intramolecular chaperones
  Subtilisin family
   PTSG_10288
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII
Motif
Other DBs
NCBI-GeneID: 16068862
NCBI-ProteinID: XP_004988338
UniProt: F2UQV9
Position
Unknown
AA seq 1226 aa AA seqDB search
MTTVADNTHAAELSALIPAQETGALAIQRNDPECDGRGIRIAVFDTGVDPAALHLKTTTD
GKPKIIDIVDTTGSGDVDMKKVVKLGDDRSFKTLTGRTFKVPEAWACPSGEVRVGVKAAF
ELFPTPLIRRLKRKRKEDWEKKARAVTRAAEAEETAAKDKTPDDEARLKELKARVGALSS
HVGGYADHGPVLDCIAFNNGTEWMAVVADETVTDLSSVSPMGDYKQRQEYGLFSDEDQMS
YSFKFYADGDILSIVTTSGSHGTHVAGILGAHDESSSERNGVAPGVQVVSVKIGDGRLDS
METGAGIIRGVNAAIDNGCHLINMSFGEASAVPNAGHVVRALQDAVREKGIIFIGSASNS
GPALSTLGCPGGLSSALIGVGAYASSALMASSYALPHPVPDVQYTWSSRGPTPDGATGVC
ISAPGGAITDVPTYNLKSTQLMNGTSMSSPNMCGSAAVLLSALMKRGIPWSPFSVRKALE
NTAKPLSGSTPLDNGQGVAQVDKALDLLVNHRDDLSFLPEYKVEAGYFAMGGRGIYLRDP
GHFTQDRVEAIVSVTPSFHKDTPKEDLIHFECPLSLVCDKSWVNVASFLLMNNSTRSFGV
HVNTGDLEPGLHYTEIRAYRVGDADAGPVFRVPVTVCKPTPLAAPQSTATTSAVMSAGAV
KRYFYAVPSGVTGCKVTVTGGAFEGSRRFILHAVQLAHQKPFNNAELHRFFALRERETTT
FELAINGDRGLEVCVAQWWSSAGACDITITVEFIGLDLRGDRTFAGPARLDALCTLGKVT
LQPKVQYTTLERVIFPVRAGTVRPLREERNVLIDGSHMYALELSYSFSLSDKANVYPVLP
GVSDFLYEGDMHNQLWMIFDDNNRILQRGDAFPNRYKTDLKKGSYTIVYQLRHSSKSKLE
DMKESHILLIQKLKSPLSASVYSVQPGTTAQQSFSKMDLVRGRSVPVFVEPVKASKLPKD
AAHGDVLSGTITMAADAQWSTWCVRALVTKGKVKPAETTSSSSKKSKKNKKNKAYKDAIK
AADLDFIKSATKDDVDVLAEIGERHAGALDVQLAVITKRFDLTDSKESLLPLIEEAVDSV
DTRALAEYFGRTDVVEEETQEAKDAAAKRKEDMTSTKSNLIALLLLQLKCALELEGDART
NTARTAITNAKRWTDPYKDSKWALSLAKYHMAREEYGQALQCIGDETSKDAFELKQQLFD
KLGWTDLFDSRSVHVLFPSARPLFVE
NT seq 3681 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgttgccgacaacacgcatgctgctgagctgtctgcgctgattcccgcgcaa
gagactggtgcccttgctattcagcgcaacgacccggagtgtgacgggcgtggcatccgc
atcgccgtctttgacacgggtgtcgaccctgcggcccttcatctcaagaccaccaccgat
ggcaagccaaagatcatcgacatcgttgacaccacagggagtggtgacgttgacatgaag
aaggttgtcaagctcggagatgaccgctccttcaagacgcttacaggccgcaccttcaag
gtgccggaggcgtgggcgtgcccgagtggtgaagtccgtgtgggcgtgaaggcggccttt
gagctattcccaacgccgctgattcgccgactcaagcgcaagcggaaggaagactgggag
aagaaagcgcgtgcagtgacgcgggcggcggaggccgaggagacggcggcaaaggacaag
acccccgacgacgaggcacggctgaaggagctcaaggcgcgggttggggcgctgtcgtcc
cacgtgggcggatacgcagaccacgggcccgtcctcgactgcatcgccttcaacaacggc
acggagtggatggccgtggttgctgacgagactgtgacggacttgagcagcgtcagcccc
atgggcgattacaagcaacggcaggagtacggcctgttctctgacgaggaccagatgtcg
tactcgttcaagttctacgcagacggcgacatcctctccatcgtcaccacctcaggctcg
cacggcacgcacgttgcgggcatcctgggagcgcacgacgagagcagcagcgagcgcaac
ggcgtcgcgcccggggtgcaggtcgtctccgtgaagattggggacgggcgcttggactcg
atggagaccggtgccggcatcatccgcggtgtcaacgccgccatcgacaacggctgccac
ctcatcaacatgtcctttggcgaggcaagcgccgtgccaaacgccgggcatgtggtgcgt
gcgctgcaggatgctgtgcgggagaaaggcatcatcttcattggctctgcgagcaacagc
ggcccagccctctccaccctcggctgccccggcggcctctcctctgccctcattggcgtg
ggcgcgtacgcctcctccgcactcatggcctcctcctatgcactgccccaccccgtaccg
gatgtgcagtacacgtggtcgtcgcgcgggcccacgcccgacggcgccaccggcgtgtgc
atctccgcaccgggcggcgccatcacggacgtgccgacgtacaacctcaagagcacgcaa
ctgatgaacgggacgtccatgtcgagcccaaacatgtgcggatctgccgcggtcctcctc
tccgccctcatgaagcgcggtatcccgtggtctccattcagcgtgcgcaaggcgcttgag
aacacggcaaagcctttgagcgggagcacaccgctggacaacgggcagggcgtggcgcag
gtggacaaggccctggacctcctcgtgaaccatcgcgacgacctgtccttcctgccagag
tacaaggtggaggctggctactttgccatgggtgggcgtggcatctaccttcgtgatcca
ggccactttacgcaagaccgcgtggaggcaattgtgtccgtcacgccgtccttccacaag
gacacgcccaaggaggacctcattcacttcgagtgcccactgtcgctggtgtgcgacaag
tcgtgggtgaacgtcgccagcttcctcctcatgaacaacagcacccgctcctttggcgtg
catgtgaacacgggggaccttgaacccggcctgcactacacggagattcgcgcgtaccgc
gttggagatgccgatgctggccccgtcttccgcgtgcccgtgacggtgtgcaaaccaacg
ccgctcgccgcgccccagagcaccgccaccaccagcgcagtcatgtccgcaggcgccgtg
aagcgctacttctatgctgtcccctctggggtgaccgggtgcaaggtgacagtgactggc
ggcgcctttgagggctcgcgtcgcttcatcctccacgccgtgcagctcgcacaccagaag
cccttcaacaacgcagagctgcaccggttctttgcgctccgagagcgcgagacgacgacg
tttgagctcgccatcaacggggaccgcgggctggaggtgtgcgttgcgcagtggtggtcg
tcggccggcgcgtgcgacatcaccatcaccgtcgagtttattggcctcgacctcaggggc
gatcgcacattcgcagggcccgcccgcctggatgcgctgtgcacgctgggtaaagtgacg
ctgcagcccaaggtgcagtacacgacgctcgagcgcgtcatcttccccgtgcgtgcaggc
accgtccgcccgctgcgggaggagcgaaacgtgctgattgacgggagccacatgtacgcg
ctcgagctctcctactccttctccctcagcgacaaggcgaacgtgtaccccgtgctgcct
ggggtgtctgacttcctgtacgagggcgacatgcacaaccagctgtggatgatctttgac
gacaacaaccgcatcctgcagcgcggcgacgcattccccaaccgctacaagacggacctc
aagaaaggctcatacaccatcgtctaccagctgcgccattcgagcaagtcgaagctcgag
gacatgaaggagtcccacattctcctcatccagaagctcaagtctccgctgagtgcgagc
gtgtacagcgtgcagcccggcaccaccgcccagcagtccttctcaaagatggacctcgtc
cgcggcaggagtgtgcctgtgtttgttgagcccgtgaaggcgtcgaagcttcccaaagat
gctgcgcacggggacgtgttgagcggcaccatcaccatggccgccgatgcacagtggtcg
acgtggtgcgtgcgcgcgctggtgaccaagggcaaagtgaagcctgccgagaccaccagc
agcagcagcaagaagagcaagaagaacaagaagaacaaggcgtacaaggacgcaatcaaa
gctgcagacctcgactttatcaagagcgcgacgaaggacgatgttgacgtgctggctgag
attggggagcgccatgccggtgccctcgatgtgcagctcgctgtcatcaccaagcgcttt
gacctcacagacagcaaggagagcctgctgccgctgattgaggaggccgtggacagcgtg
gacacgcgtgcgcttgcagagtactttgggcggacagatgttgttgaggaggagacgcag
gaggcgaaggacgccgcggccaaacgcaaggaagacatgacatccaccaagtcgaacctc
atcgccctcttgcttctccagctcaagtgtgcgcttgagctggaaggggacgcccgcacc
aacacggcccgcaccgccatcaccaacgcaaagcgctggacagacccatacaaggactcg
aagtgggcactgtcgcttgccaagtaccacatggcgcgtgaggagtacggacaggcgctg
caatgcattggcgacgagacgagcaaggacgcctttgagctcaagcagcagctctttgac
aagctcggctggacggatctgtttgacagccgcagcgtgcacgtgctcttccccagcgcc
cgccccctctttgtggagtga

DBGET integrated database retrieval system