KEGG   Salpingoeca rosetta: PTSG_10400Help
Entry
PTSG_10400        CDS       T04136                                 

Definition
(RefSeq) hypothetical protein
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
sre  Salpingoeca rosetta
Pathway
sre00071  Fatty acid degradation
sre01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PTSG_10400
Enzymes [BR:sre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     PTSG_10400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 16068981
NCBI-ProteinID: XP_004988451
UniProt: F2UR71
Position
Unknown
AA seq 456 aa AA seqDB search
MRVVLQAAVLKTARRALTSDGYLHKTVIPTFKFQDSLPKLKIPKLEDSLQKYVASATPLV
SPDELQQTKAVVDDFANTEGKILQDHIVAEDKKHYSSYISAPWFDMYLRFRDPLPINMNP
QLTMKDDPDPAKHKQAPRAASLISASVAFYRTLRDRQLSPDVYHTKPHRSETPFFQQLVK
MAPNAAAWYIGFGFGAFALDMSQYANLFSSTRVPQPTKDQLVVFDERQSRHIIIQYGHDF
FKLNVLHQDGTAVPEAEIRAALEDITSKPASTAAPPLGAATTMNRDKWATLRNKVMGASP
RNLQHMSDIDSALFAVCLEDSAPGCAPMTPLGGATGDEYVELSEAMLYGNGRNRWFDKSF
QLIVTENGKSAVNFEHSWGDGVAVLRYFQEVYKESIATPTPDPRPKEQAVKLDFDFTDEL
SAELKTAAEEFDAFKNTIDMKVLQTQVRSASHMRWM
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtggtgctccaagcagccgtcctcaagacggcgcgtcgcgctctcacgagtgac
ggctacctccacaagactgtgattccgacgttcaagtttcaggactcgttgcccaagctg
aagatcccaaagctggaagactcgctgcagaagtatgtggcctccgccaccccactcgtc
tcgcctgatgagctgcagcagaccaaggccgttgtcgacgactttgccaacaccgagggc
aagatcctgcaggaccacatcgtggccgaggacaagaagcattactcgagctacatctca
gcgccctggtttgacatgtatctccgcttccgtgatcccctccccatcaacatgaacccg
cagctgacgatgaaggacgaccctgatccggcgaagcacaagcaggcgccacgcgctgcc
agcctcatctccgcctctgtcgccttttaccgcaccctccgcgacaggcagctcagccca
gatgtgtaccacacaaagccgcaccggagcgagacgccgtttttccagcagctggtcaag
atggcgcccaacgcggccgcatggtacatcggctttgggttcggcgcgtttgcacttgac
atgagccagtacgccaacctgttcagctccacgcgtgtgccgcagccgaccaaggaccag
ctcgttgtctttgatgagcgccagagccggcacatcatcatccagtacggccacgacttt
ttcaagttgaatgttcttcaccaggacggcaccgccgtcccagaggcagagattcgcgct
gcgcttgaggacatcacgtccaagcccgcatcaacggccgcgcccccgctcggcgccgcc
accacgatgaacagggacaagtgggctaccctcaggaacaaggtgatgggtgcatcgccg
cgcaatctgcagcacatgtcggacatcgactccgccctctttgccgtctgcctcgaggac
tctgcccccggctgtgcgcccatgacgccgctcggtggcgccaccggtgatgagtacgtc
gagctgtcggaggcgatgttgtacggtaacggcaggaacagatggttcgacaagagcttc
cagctgattgtgacggagaacggaaagtccgcggtcaactttgagcactcgtggggagat
ggcgtggccgtgctcaggtatttccaggaggtgtacaaggagagcattgcaacgccgaca
ccggacccaaggccaaaggaacaggctgtgaaactcgactttgactttacggacgagctg
agcgccgagctgaagaccgcggcggaggaattcgacgccttcaaaaacacgattgacatg
aaagtcctccagacacaggtgcgcagtgcttcacatatgcgatggatgtga

DBGET integrated database retrieval system