KEGG   Candidate division SR1 bacterium Aalborg_AAW-1: XF24_00064Help
Entry
XF24_00064        CDS       T04487                                 

Gene name
mqo
Definition
(GenBank) Malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
srg  Candidate division SR1 bacterium Aalborg_AAW-1
Pathway
srg00620  Pyruvate metabolism
srg01100  Metabolic pathways
srg01110  Biosynthesis of secondary metabolites
srg01120  Microbial metabolism in diverse environments
srg01130  Biosynthesis of antibiotics
srg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:srg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XF24_00064 (mqo)
   00620 Pyruvate metabolism
    XF24_00064 (mqo)
Enzymes [BR:srg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     XF24_00064 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO GMC_oxred_N NAD_binding_8 Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AKH32429
UniProt: A0A288GS71
Position
complement(66353..67825)
Genome map
AA seq 490 aa AA seqDB search
MKSQEQYNIILVGAGIMSATLATLLSELNPEYKIAIIERLDEMAQESSAAMNNAGTGHSA
FCELNYTPQDKDGNISIAKAISIAEQFEISKQFWSSLVEKNSIADPSCFISQIPHSSLVF
GEENVQYLKKRYQAMIHSPLFSDMQYSEDHEEIIKWMPLVMKGRDMSERIAATRMEIGTD
VNFGALTKLMIDNLVQRQNVTLLLGKEVKDLTQLDDKSWSVEVGSTHGSNDHKTLTTKLI
FLGAGGGALPLLQRSGIEERKQFGGFPVSGQWLICTNPDIVAQHEAKVYGKAALGAPPMS
VPHLDTRMIDGKKALLFGPYAGFTTKYLKKGSFFDLFGSLRLYNIWTMLQAGARNLGLTK
YLIEQVVQSSSTRFKALQEYMPSAEPKDWELIEAGYRVQVIKNDPKQGGILQFGTEVVVS
EDKSLSTLLGASPGASTAVSVMINIIEQCFPQFIGKLPELIPSYGKALYQDTTLLKNMRD
WTGKILKIHY
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatcacaagaacagtataatattatcctcgtaggagctggaattatgagtgctact
ctggctactctcctctctgaactgaatcctgagtataagattgctattatcgagcgtttg
gatgagatggcacaagaaagtagcgctgcgatgaataatgcaggaacgggacattcagca
ttctgtgaactgaactatactccacaagataaagatggaaatatcagtattgcaaaagca
atcagtattgcagaacaatttgagatttcaaaacagttttggtcgagtttggtcgagaag
aatagtattgcagatccttcttgctttatatctcagattcctcattctagtctggtcttc
tgagaagaaaatgtccaatatctcaaaaaacgttaccaagctatgatacactctcctctc
ttttcagatatgcagtatagtgaagaccatgaagagattattaagtggatgcctttggtt
atgaaatgacgtgatatgagtgaaagaatagctgcaactcgtatggaaattggtactgat
gtgaatttcggagcccttacgaaacttatgattgataacttagtacaacgtcagaatgtt
actcttttgctatgaaaagaggtaaaagatctgacccagttagatgataagagttggtca
gttgaagtagggtcgactcatggaagtaacgatcataaaacacttactacaaaacttatc
ttcttatgagctggtggtggtgcgctgccgcttcttcagagatcatgaattgaagagaga
aaacaatttggctgatttcctgtaagcggtcagtggctcatctgtacgaatcctgatatt
gttgcacaacacgaagcgaaagtctacggtaaagcagcactatgagctccccctatgtca
gttcctcatttggatactcgtatgattgatgggaagaaagcactcctcttctgaccctac
gcagggtttaccactaagtatctgaagaaaggttcattcttcgatttatttggttctctt
cgtctctataatatctggacgatgttgcaagcaggagcaagaaatcttggtctgacaaaa
tatctcatagagcaagtggttcagagttcatctacacgtttcaaagcactacaagaatat
atgccaagtgctgagcctaaggattgggaacttatagaagcaggatatcgtgttcaagtg
ataaaaaatgatcccaaacaatgaggtatactacagtttggtacagaagtagttgtgtca
gaagataaatctttatctactcttctctgagcttctccatgagctagtacggcagtatca
gtcatgattaatattatagaacagtgttttccacaattcattggtaagcttccagaactt
ataccatcgtatggtaaagcactttatcaagatactactcttttgaaaaacatgagagat
tggacagggaagatattaaaaatacattattaa

DBGET integrated database retrieval system