KEGG   Stenotrophomonas rhizophila: BAY15_0522Help
Entry
BAY15_0522        CDS       T04500                                 

Definition
(GenBank) pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
srh  Stenotrophomonas rhizophila
Pathway
srh00250  Alanine, aspartate and glutamate metabolism
srh00330  Arginine and proline metabolism
srh01100  Metabolic pathways
srh01110  Biosynthesis of secondary metabolites
srh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:srh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BAY15_0522
   00330 Arginine and proline metabolism
    BAY15_0522
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srh03000]
    BAY15_0522
Enzymes [BR:srh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     BAY15_0522
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     BAY15_0522
Transcription factors [BR:srh03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    BAY15_0522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: AOA70956
UniProt: A0A1B2N0B7
Position
complement(629031..632255)
Genome map
AA seq 1074 aa AA seqDB search
MTAPSALPPAPAPSGASRPPLLSPELPAVPNAFRQAITDAWMKDEASHVRELLAQARLPA
DEQAKVQATAADLVKRVRVRAKDQGAIEAFMRQYDLGSEEGVLLMCVAEALLRIPDQDTA
DKLIRDKLGEADWKKHLGGSDSVLVNASTWGLMLTGHIVQINDSTRADVPGAFARLMGRV
GEPVIRLAVRQAMKIMGHQFVMGRTIDEALSRSHKGDNASYRYSFDMLGEGALTMKDAKR
YLEDYRRAIHSIGGDHKARGGRPDGDVNSAPGISIKLSALYPRYEHAKRARVMADLVPGV
LELARLAKSYGIGCTVDAEETDRLELSLDIIEAVVSDASLAGWEGFGVVVQAYQKRTPYT
IDYLADLARRIGRRLQVRLVKGAYWDAEIKRAQIDGLPAYPVFTRKQNTDVSYLACAKRL
FTHADAIYPMFATHNAHTIAAVQAIAQGGQYEHQKLHGMGDDLYAEVVPANRLNVPCRVY
APVGSHEDLLPYLVRRLLENGANSSFVNRITDDAVAIDDLIRDPVDAVASFDSIPHPKIP
LPVDLLRSQNHDRKNSMGVNLANDNDLRALAEQLNAAVKPWQAAPLVPGAQPTGALLNVV
NPADTRQVVGQWQPADSATVEKALANAVAAQPQWNRTPAASRAAILEHAADQLEARLPEF
MALCVKEAGKSLPDGIAEVREAVDFLRYYAKQAREQFGHAEKLPSPTGESNELQLHGRGV
FVCISPWNFPLAIFLGQVAAALAAGNSVIAKPAEQTNLIGYYAVKLLLDAGVPEGVVQFL
PGDGATVGAALTADPRVAGVAFTGSTDTARAINRAMAARDAAIGVLIAETGGQNAFIADS
SALPEQLVKDAIGSAFTSAGQRCSAARVLFVQDDIADKVMTMLAGAMAELKIGDPGLLST
DVGPVIDADALQILQEHAVRMEKEARLIAAAELSEAAAHGTFFAPRAYELKNLDQLHKEI
FGPVLHVIRWKGDQLDAVIDQINATGYGLTLGVHSRIDETVDRISSRVNVGNVYVNRNQI
GAVVGVQPFGGQGLSGTGPKAGGPHYLLRFATEKTVTVNTTAAGGNASLLTLGD
NT seq 3225 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaccttccgcgcttccccctgccccggccccgtccggcgcctcccgcccgccg
ctgctgtcccccgagctgccggccgttcccaatgcgttccgccaggcgatcaccgatgcc
tggatgaaggacgaggccagccacgtgcgcgagctgctggcgcaggcgcgcctgcccgcc
gacgagcaagcgaaggtgcaggccaccgccgccgacctggtcaagcgcgtacgcgtgcgt
gccaaggaccagggcgcgatcgaagccttcatgcgccagtacgacctgggcagcgaggaa
ggcgtgctgctgatgtgcgtggccgaagcgctgctgcgcattccggaccaggacaccgcc
gacaagctgatccgcgacaagctcggcgaagcggactggaagaagcacctgggcggcagc
gattcggtgctggtcaacgcctccacctggggcctgatgctcaccggccacatcgtccag
atcaacgactccacccgcgccgacgtgccgggcgcattcgcgcgcctgatgggccgcgtg
ggtgagccggtgatccgcctggccgtgcgccaggcgatgaagatcatgggccaccagttc
gtcatgggccgcaccatcgacgaagcgctgtcgcgctcgcacaagggcgacaacgccagc
taccgctattcgttcgacatgcttggcgaaggcgcgctgaccatgaaggacgccaagcgt
tacctggaagactaccgccgcgcgatccactccatcggtggcgaccacaaggcccgtggc
ggccgcccggatggcgacgtcaattcggccccgggcatttccatcaagctgtcggcgctg
tacccgcgctatgagcacgccaagcgcgcgcgcgtgatggccgacctggtcccgggcgtg
ctggaactggcacgactggccaagtcgtacggcatcggctgcacggtggatgccgaggaa
accgaccgcctggaactgtcgctggacatcattgaagcggtggtgagcgatgcctcgctg
gccgggtgggaaggcttcggcgtggtggtgcaggcgtaccagaagcgcaccccgtacacg
atcgactacctggccgacctggcccgccgcatcggccgtcgcctgcaggtgcgcctggtc
aagggcgcgtactgggacgcggagatcaagcgcgcccagatcgacggcctgccggcctac
ccggtgttcacccgcaagcagaacaccgacgtgtcctacctggcctgtgccaagcgtctg
ttcacccatgccgatgcgatctacccgatgttcgccacgcacaacgcgcacaccatcgcg
gcggtgcaggcgatcgcgcagggtggccagtacgaacaccagaagctgcacggcatgggc
gatgacctgtacgccgaagtggtgccggccaaccgcctgaacgtgccgtgccgcgtgtac
gcaccggtgggttcgcacgaagacctgctgccgtacctggtgcgccgcctgctcgagaac
ggcgccaactccagcttcgtcaaccgcatcaccgacgacgcggtggccatcgatgacctg
atccgcgatccggtcgacgccgttgcctcgttcgattccattccgcacccgaaaatcccg
ctgccggttgacctgctgcgcagccagaaccacgacaggaagaattccatgggcgtcaat
ctcgccaacgacaacgatctgcgcgccctggccgagcagctcaacgccgccgtcaagccg
tggcaggccgctccgctggtgccgggtgcacagcccaccggcgcgctgttgaacgtggtc
aacccggccgacacgcgccaggtagtgggccagtggcagccggccgacagcgccaccgtg
gaaaaggccctggccaacgccgtggccgcccagccgcagtggaaccgcactccggccgcc
agccgcgcggcgatcctggaacatgctgccgaccagctggaagcccgcctgcccgagttc
atggcgctgtgcgtcaaggaagccggcaagagcctgcccgacggcatcgccgaagtgcgc
gaagcggtggacttcctgcgctactacgccaagcaggcgcgcgagcagttcggccatgcc
gagaagctgcccagcccgaccggtgaatccaacgagctgcagctgcatggccgcggcgtg
ttcgtgtgcatcagcccgtggaacttcccgctggcgatcttcctgggccaggtcgccgcc
gcgctggccgccggcaacagcgtgatcgccaagccggccgaacagaccaacctgatcggc
tactacgcggtgaagctgctgctggacgccggcgtgcccgaaggcgtggtgcagttcctg
ccgggcgacggcgccaccgtgggtgccgcgctcaccgccgacccgcgcgtggccggcgtg
gccttcaccggttcgaccgataccgcgcgcgcgatcaaccgtgcgatggcggcccgtgat
gctgcaatcggtgtgctgatcgccgaaaccggcggccagaacgccttcatcgccgattcc
tcggcgctgccggaacagctggtcaaggatgcgatcggttcggcgttcacctcggccggc
cagcgctgctcggccgcgcgcgtgctgttcgtgcaggacgacatcgccgacaaggtgatg
accatgctggccggtgcgatggccgagctgaagatcggcgatccgggcctgctgtcgacc
gacgtcggcccggtgatcgatgccgatgcgctgcagatcctgcaggaacatgcggtgcgc
atggagaaggaagcgcgcctgatcgccgctgccgagctcagcgaagcggccgcgcacggc
accttcttcgcgccgcgtgcgtatgagctgaagaacctggaccagctgcacaaggaaatc
ttcgggccggtgctgcacgtgatccgctggaagggcgaccagctcgatgcggtgatcgac
cagatcaacgccaccggctacggcctaaccctgggcgtgcattcgcgcatcgacgaaacc
gtggaccgcatttcctcgcgggtgaacgtgggcaacgtgtacgtcaaccgcaaccagatc
ggtgcggtggtgggcgtgcagccgttcggcggccagggcctgtcgggcaccggtccgaag
gccggcggcccacactacctactgcgttttgccaccgagaagaccgtcaccgtgaacacc
accgcggccggtggcaatgcgtcgctgctgacgttgggcgattga

DBGET integrated database retrieval system