KEGG   Stenotrophomonas rhizophila: BAY15_3546Help
Entry
BAY15_3546        CDS       T04500                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
srh  Stenotrophomonas rhizophila
Pathway
srh00780  Biotin metabolism
srh01100  Metabolic pathways
Module
srh_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:srh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BAY15_3546
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:srh01007]
    BAY15_3546
Enzymes [BR:srh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     BAY15_3546
Amino acid related enzymes [BR:srh01007]
 Aminotransferase (transaminase)
  Class II
   BAY15_3546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AOA73978
UniProt: A0A1B2N8W2
Position
4069298..4070509
Genome map
AA seq 403 aa AA seqDB search
MARTDLHDRIQSQRKLREAQGRIRVRRTVTRRDGVRLEVNGQWLTGFCSNDYLGLSQQFG
VVSALQDAAAREGAGAGASHLICGHHALHEALEQEVADWLGYPRALLFGSGFAANLAVQQ
ALLSEEDDVCVQDRLNHASLLDATRLAGCRLRRYPHLDTEGALRQLKHAPDGAAMLVTDG
VFSMDGDIAPLRSLSLVARMQEAVLYVDDAHGVGVIGEHGRGCVADAGLGVADVPLQLVT
LGKALGGSGALVVGDEAMIQHLAETARPYIYTTAVPPAQAAAALAAVKLARRDDWRREKL
AELVGVFRAGARQHGLELMPSDTPIQPLLCGAESTVMGLSAALEAAGFLVSAIRPPTVPE
GKARLRVTLSALHTVPEVRALTDAIAHARDQVLRQQALDALSA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtaccgacctgcacgaccgcatccagtcccagcgcaagcttcgcgaagcgcag
ggtcgtatccgcgtgcgccgcacggtaacccggcgcgatggcgtgcgcctggaggtcaat
ggccagtggctcaccggcttctgcagcaatgactatctgggcctgtcccagcagtttggc
gtggtcagcgcgctgcaggatgccgccgcgcgcgaaggcgccggggcgggcgcctcacac
ctgatctgcggccaccatgcgctgcatgaagcgctggaacaggaagtggccgactggttg
ggctacccgcgtgcgctgctgtttggcagcggctttgccgccaacctggcggtgcagcag
gcactgctcagcgaagaagacgatgtgtgcgtgcaggaccggctcaaccacgccagcctg
ctcgatgccacgcgcctggccggctgccgcctgcgccgctacccgcacctggataccgaa
ggtgcgctgcgccagctcaagcacgcgcccgacggcgcggcgatgctggtcaccgatggt
gtcttcagcatggatggcgacatcgccccgctgcgctcgctctcgctggtggcgcgcatg
caggaagcggtgttgtacgtggacgacgcacacggcgtgggcgtgatcggcgagcacggc
cgcggctgcgtggccgacgccgggctgggcgtggccgacgtgccgctgcagctggtcacg
ctgggcaaggccttgggtggcagtggcgcgctggtggtgggcgacgaggcgatgatccag
cacctggccgaaaccgcacgcccctacatctacaccacggcggtgccgccggcgcaggcg
gctgcggcattggccgccgtgaagctggcacgccgcgacgactggcgccgcgagaagctg
gccgagctggtcggcgtgttccgtgccggcgcgcgccagcatgggctggaactgatgccc
tccgatacgccgatccagccgctgctgtgcggggccgaatcgacggtgatgggcttgtcg
gccgcgctggaagcggctggtttcctggtcagcgcgatccgtccgccgaccgtgcccgag
ggcaaggcacgcctgcgcgtgaccctgtcggcgctgcacacggtgccggaagtacgtgcg
ctcaccgatgccatcgcccacgcacgcgaccaggtgctgcgccagcaggcactggatgcg
ctgagcgcgtga

DBGET integrated database retrieval system