KEGG   Selenomonas ruminantium: SELR_10000Help
Entry
SELR_10000        CDS       T01799                                 

Gene name
trpC
Definition
(GenBank) putative indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sri  Selenomonas ruminantium
Pathway
sri00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sri01100  Metabolic pathways
sri01110  Biosynthesis of secondary metabolites
sri01130  Biosynthesis of antibiotics
sri01230  Biosynthesis of amino acids
Module
sri_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sri00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SELR_10000 (trpC)
Enzymes [BR:sri01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SELR_10000 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh ThiG IMPDH His_biosynth QRPTase_C NanE DUF1863 TolB_N
Motif
Other DBs
NCBI-ProteinID: BAL82708
UniProt: I0GPM1
Position
1085319..1086125
Genome map
AA seq 268 aa AA seqDB search
MNVLERLAAHAAERVAAAKGQKPLAQVRREAESLPKGEFPFKRALAHKDLSFICECKKAS
PSKGLIAPHFPYLEIAKDYEAAGADAISVLTEPSEFLGSDRYLQEITAAVQTPCLRKDFT
IDEYMIYEAKVLGASAVLLICSLLETERIKEYMAVAADVGLSALVEAHDEWEIESALKAG
AEIIGVNNRNLKDFSVDIESSGRLRSMVPPEVLFVSESGVKSAADVQRAKAMGADAILVG
EALMRSADKNAMLADFYAAADRRRENLQ
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtattggaacgattagcagctcatgctgccgagagggtggccgccgccaaaggt
cagaagccgctggcgcaggtgcggcgggaagcggagtccctgcctaagggtgagttcccg
ttcaaacgggcactagcccataaggatctgtcctttatctgcgaatgcaagaaggcatcg
ccctccaaagggttgattgcgccgcattttccttatttagagattgccaaggattatgag
gcggctggtgccgatgccatttcggtgctgacagaacccagcgagtttttgggcagtgac
cgttatctgcaggagattacggcagcagtacagacgccctgcctgcgcaaggatttcacc
attgacgaatacatgatttatgaagctaaggtgctgggggcttcggccgtgctgctgatc
tgctccttgctggaaacggaacgcatcaaggaatatatggccgtggcagccgacgtagga
ctgtcggcgctggtggaagctcatgatgaatgggaaatcgaaagcgccctgaaagccgga
gccgagatcatcggcgtcaataaccgcaatctcaaggatttttccgtggatatcgaaagc
agcgggcggctgcggagcatggtgccgcctgaggtgctgttcgtatcagaaagcggcgtg
aagtcggctgctgatgtgcagcgggccaaggccatgggtgcggatgccatactggtgggc
gaagcactgatgcgcagtgcagataagaatgcgatgctggcggatttctatgccgctgct
gatagacgaagggagaatttgcaatga

DBGET integrated database retrieval system