KEGG   Selenomonas ruminantium: SELR_14990Help
Entry
SELR_14990        CDS       T01799                                 

Definition
(GenBank) putative dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sri  Selenomonas ruminantium
Pathway
sri00521  Streptomycin biosynthesis
sri00523  Polyketide sugar unit biosynthesis
sri01130  Biosynthesis of antibiotics
Module
sri_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:sri00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SELR_14990
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SELR_14990
Enzymes [BR:sri01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SELR_14990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: BAL83207
UniProt: I0GR20
Position
1561012..1561572
Genome map
AA seq 186 aa AA seqDB search
MKVAETKLKGVYIVEPQVFGDARGWFTESWSEKKLAEAGIKANFVQDNHSYSAQKGTLRG
LHYQLNPMCQAKMLRCTRGNIFDVAVDIRKGSPQYGQWVGVELSAENHQQLFIPRGFAHG
FITLTDDVEVQYKADNYYAPECDGNIRWDDPEIGIEWPLKPVILSDKDKVAPLLKERMDL
NFIYEG
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagcagaaacaaagttaaaaggtgtatatattgtagaaccacaggtctttggt
gatgcccggggctggtttacagagagctggtcggagaaaaagctcgcggaagctggcatc
aaggctaatttcgtgcaggataatcattcctattcagcccagaaggggactttgcgcggc
ctgcattatcagttgaatcccatgtgtcaggccaagatgctgcgctgcacccgagggaac
atcttcgatgtggctgtggatatccgcaagggttctccccagtatggccagtgggtgggg
gtggagctgtcggcggaaaatcaccagcagctcttcattccgcgcggctttgcccatggg
ttcatcacccttacggatgatgtggaagtacagtacaaggcagataattattatgcgccg
gagtgcgatggcaatatccgctgggacgatccggaaattggcatcgaatggccgttgaaa
ccggtgatcctttcggacaaggataaggttgcacctttgctcaaagagcgcatggatttg
aattttatttatgagggttaa

DBGET integrated database retrieval system