KEGG   Selenomonas ruminantium: SELR_15710Help
Entry
SELR_15710        CDS       T01799                                 

Gene name
coaBC
Definition
(GenBank) putative phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
sri  Selenomonas ruminantium
Pathway
sri00770  Pantothenate and CoA biosynthesis
sri01100  Metabolic pathways
Module
sri_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:sri00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SELR_15710 (coaBC)
Enzymes [BR:sri01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     SELR_15710 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     SELR_15710 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein YjeF_N Glyco_trans_4_5 PspC
Motif
Other DBs
NCBI-ProteinID: BAL83279
UniProt: I0GR92
Position
complement(1638978..1640177)
Genome map
AA seq 399 aa AA seqDB search
MGTLEGKKIVLGVTGGIAAYKAVEIASRLRKAGAEVHVIMTKEATEFVTELTFREITGQP
VSVDMWAKVANFNVEHIALANLADLVLIAPATANIIAKIAAGIADDMLTTTVLATKAPVM
LAPAMNTNMYENPITQRNMAELRTRGMQLIEPASGHLACGIEGKGRLPEPVDIVQAVSDF
MTEAQPLRGRKIIVTAAGTIEPLDPVRFLGNHSTGKMGYAIAAEAARQGADVLLVSGPSG
LPAPANVRIERIQTAREMQAAVQAEYAQADAVIMSAAVADYRPKAVSAEKIKKSDDELVL
HLERNPDILLGLGQQKQQQILVGFAAETCHLEEYAKKKLAKKNLDFIVANDVSARDAGFA
VDNNRVQLYFRDGRVEKYPLMAKTELAKVILDKLAAILP
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccttagaaggcaagaaaattgttttgggtgtgacgggaggcattgccgcttat
aaagcggtggagattgcctcccgtctccgcaaggcaggggcagaagtccatgtgatcatg
acaaaggaggccacagagttcgtcacggaactgacctttcgggagatcacgggacagcct
gtatctgtggatatgtgggctaaggtggccaatttcaatgtggagcatatcgccctggca
aatctggccgatttggtgctgattgcgccggcaacggcgaatatcattgccaagatcgcc
gcaggtattgccgatgatatgctgactactacggtattggcgacgaaagccccggttatg
ctggcaccggccatgaacaccaatatgtatgaaaaccccatcacccagcggaatatggca
gagctccgaacccggggtatgcagctcattgaaccggcttctggtcatctggcctgtggt
atcgagggcaaggggcgtctgccggaacctgtggatattgtgcaggcggtcagcgatttc
atgaccgaagcgcagccattgcgaggccgaaagatcattgttacggctgcggggaccatt
gaaccattggacccggttcgtttcctgggcaaccattccaccggcaaaatgggctacgcg
attgcagcggaagctgcccggcagggggcagatgtattattggtatccgggcccagcggc
ctgccggccccggcaaatgtacgtatcgagcgcattcagactgcccgtgagatgcaggcg
gctgtgcaggcggaatacgcgcaggcagatgccgtcatcatgtcggctgcagtagcggat
taccgtcccaaagcagtgtcggctgaaaagatcaagaagagtgatgatgagctggtatta
catctggagcgcaatccggacatcttgttgggactgggccagcaaaagcagcagcagatc
cttgtgggctttgccgctgaaacctgccatctggaggaatatgccaaaaagaaactggcc
aagaagaatcttgacttcatcgtggccaatgatgtttccgcaagggatgccggctttgca
gtagacaataaccgcgtccagctttatttccgcgatggccgcgtagaaaaatacccattg
atggcaaaaacggaattagccaaggtcatattggacaagctggcagcaatcctgccctga

DBGET integrated database retrieval system