KEGG   Selenomonas ruminantium: SELR_18950Help
Entry
SELR_18950        CDS       T01799                                 

Gene name
ispE
Definition
(GenBank) putative 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sri  Selenomonas ruminantium
Pathway
sri00900  Terpenoid backbone biosynthesis
sri01100  Metabolic pathways
sri01110  Biosynthesis of secondary metabolites
sri01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sri00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SELR_18950 (ispE)
Enzymes [BR:sri01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SELR_18950 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: BAL83603
UniProt: I0GS66
Position
complement(1950662..1951531)
Genome map
AA seq 289 aa AA seqDB search
MVTVEANAKINLTLDILGKREDGFHEVSMVMQSIGLHDTLSLEKIEAGIELTINVPWLKA
DEKNLAWRAAALMQEEFKLAGGVRIELIKRIPVAAGLAGGSADAAAVLKGMNELYDLGLS
QKKLCELGAQLGSDIPFCIMGGTMLATGRGEVLTRLADMPETWVVLAKPRISVSTAWAYQ
NYDEQGAEAHPDNEAIQRAIAHKNRKAVAGLLCNVLESVTIKKYDVIAAYKEMMLENGAM
ASMMSGSGPTVFGLARSREQAEAIANVLRRETNADVFVTRTFQMNRMKA
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggtaacagttgaggcaaatgccaagatcaatctgacgctggatattttgggcaagcgc
gaggatgggttccatgaggtatccatggtcatgcagtccattggcctgcatgatacctta
tccctggagaaaatcgaagcgggcattgaactgaccatcaatgtcccctggctcaaggcc
gatgagaaaaatctggcttggcgggcggcggcattgatgcaggaagaattcaagctggca
ggcggtgtgcgcatcgagctcatcaagcgcattccagtggcggcagggctcgccggcggc
agtgcagacgcggctgcggtgctcaagggcatgaatgagctctacgatctcggcttgtcc
cagaaaaagctctgcgagctgggcgcgcagctgggctcggatatccccttctgcatcatg
ggcggcaccatgttggccacgggccgaggagaagtcctcacgcgccttgccgatatgccg
gagacctgggtggtactggctaaaccccgcatctccgtatccacggcctgggcttatcag
aattatgatgagcagggcgctgaagcccatccggacaatgaggccatccagcgcgccata
gctcataagaatcgaaaagccgtggcggggttattgtgtaatgtgctggaaagtgttact
attaaaaagtatgatgtgattgcggcatacaaagagatgatgctggaaaacggcgctatg
gccagcatgatgtccggcagcggcccgactgtctttggcctggcgcgcagtcgggaacag
gcagaggccattgccaatgtcctgcgtcgggaaaccaatgccgatgtttttgttacgcgt
acttttcagatgaaccgcatgaaagcatga

DBGET integrated database retrieval system