KEGG   Selenomonas ruminantium: SELR_24170Help
Entry
SELR_24170        CDS       T01799                                 

Gene name
tpiA
Definition
(GenBank) putative triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sri  Selenomonas ruminantium
Pathway
sri00010  Glycolysis / Gluconeogenesis
sri00051  Fructose and mannose metabolism
sri01100  Metabolic pathways
sri01110  Biosynthesis of secondary metabolites
sri01120  Microbial metabolism in diverse environments
sri01130  Biosynthesis of antibiotics
sri01200  Carbon metabolism
sri01230  Biosynthesis of amino acids
Module
sri_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sri_M00002  Glycolysis, core module involving three-carbon compounds
sri_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sri00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SELR_24170 (tpiA)
   00051 Fructose and mannose metabolism
    SELR_24170 (tpiA)
   00562 Inositol phosphate metabolism
    SELR_24170 (tpiA)
Enzymes [BR:sri01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SELR_24170 (tpiA)
Exosome [BR:sri04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SELR_24170 (tpiA)
  Exosomal proteins of bladder cancer cells
   SELR_24170 (tpiA)
  Exosomal proteins of melanoma cells
   SELR_24170 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAL84125
UniProt: I0GTN8
Position
complement(2536956..2537705)
Genome map
AA seq 249 aa AA seqDB search
MARTPIIAGNWKMNNTIKEGVELVKALAPLVKDATVDVVVCPTATALSSVCEAVKGTNIH
VGAQNVHWEAKGAFTGEISTGMLNEIGVDYVVLGHSERRDYFGETDEGVNKRARAAFAAG
ITPIICCGESLEIREAGTYIDHVVAQINAALEGFEASEVAKLVIAYEPIWAIGTGKTATF
EQAEEVCKAIREAVAKKFDQTAADAIRIQYGGSVKPATIKDLMQQPNVDGALVGGASLKA
EDFSAIVNF
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggctagaactccgattattgcaggcaactggaagatgaacaacacgatcaaggaaggc
gttgagctggttaaggctctggctcctctcgttaaggatgctacggtagacgttgtggtt
tgcccgacggctacggctctttcttccgtttgcgaagctgttaaaggcaccaacatccat
gttggcgcacagaacgttcattgggaagcaaaaggtgctttcacgggcgaaatctccacg
ggcatgctcaacgaaatcggcgtagattacgttgtacttggccacagcgaacgccgtgac
tacttcggtgaaacggatgaaggcgtaaacaagcgcgctcgtgctgcttttgctgctggc
atcacgccgatcatctgctgcggtgaatccctggaaatccgcgaagctggcacttacatc
gaccacgttgtggctcagatcaatgctgctctcgaaggtttcgaagcttccgaagttgca
aaactcgttatcgcttatgaaccgatctgggctatcggcacgggcaagacggctaccttc
gaacaggctgaagaagtctgcaaggctatccgtgaagctgttgccaagaaattcgaccag
acggcagctgacgctatccgcatccagtacggcggcagcgtgaaaccggctacgatcaaa
gacctcatgcagcagccgaacgttgacggcgctctcgtaggcggtgcttccctgaaggct
gaagatttcagcgctatcgtaaacttctaa

DBGET integrated database retrieval system