KEGG   Streptomyces rectiverticillatus: FGW37_00305
Entry
FGW37_00305       CDS       T06927                                 

Definition
(GenBank) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
srk  Streptomyces rectiverticillatus
Pathway
srk00100  Steroid biosynthesis
srk01100  Metabolic pathways
srk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    FGW37_00305
Enzymes [BR:srk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     FGW37_00305
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-ProteinID: QLE70262
Position
complement(56523..57635)
AA seq 370 aa
MAALALMDFVLVAFVLVLFAGSRWIPGRSVPAAATEDLAAAGDTDTETEPPRAYRLNGAW
LFALTAGAAAGFWIWSPRVLVWPDRHWGELLLVANAFAFALAWLLFRTGRRRTPAASGPS
GRRRGLSDYFYGVERNPVWAGVDLKFFSYRPSLIGLFVFNVSAAAVQYTGQGSLSGRMLL
YQIFFFVYLANYFQFEGGMVHTWDLIAERFGWMLVWGDYVLVPFFYGISGRTLIHVREPL
PLWLGAVCCALFVFGFWLFRGANDQKHRFKTGGAVTIWGRPAETLGGRLLVSGFWGIGRK
LNYTGELLVYLSWTLLCGTGSVVPYLLPAFLLLMFVHRAHRDDRRCRVKYGRLWEEYCRR
ARFRMFPFVY
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggctgctctcgccctgatggatttcgtgctggtggctttcgtcctggtgctgttcgcg
ggttcccgctggattcccggacggtcggtgccggcggcggcgacagaagacctggcggcg
gcgggggatacggatacggagacggagcctccgcgggcctaccgcctcaacggtgcctgg
ctcttcgcgctgaccgcgggcgccgcggcgggattctggatctggtcaccgcgggtgctc
gtctggccggaccggcactggggagaactcctgctggtggccaatgcgttcgcgttcgca
ctggcctggctgctgttccgcaccggccggcgccggacgccggccgcgtccggcccgtcc
ggacggcggcgcggcctgagtgactacttctacggagtggagaggaaccccgtatgggca
ggggtcgacctgaagttcttctcctaccggccctcactcatcgggctcttcgtgttcaac
gtgtcggccgcggctgtccaatacacgggtcagggttcgttgagcggccggatgctgctc
tatcagatcttcttcttcgtctacctggccaactatttccagttcgaaggcggcatggtc
cacacgtgggacctcatcgccgagaggttcggatggatgctggtgtggggggactacgtt
ctcgtgccgttcttctacggcatctccggacgcacgctgatccacgtccgggagcccctt
cccctgtggctgggagcggtgtgctgtgcgttgttcgtcttcggattctggctcttccgc
ggagcgaacgaccagaagcaccgcttcaagaccggtggcgccgtcaccatttggggccgt
ccggccgagacactgggcggcaggctcctggtgtccgggttctggggcatcggcagaaag
ctgaactacaccggcgaactgctggtgtacctcagctggacgctgctgtgcggcaccggc
tccgtcgttccgtacctgctcccggccttcctgctgctgatgttcgtgcaccgggcgcac
cgtgacgaccgccgctgccgcgtcaagtacggccggctttgggaggagtactgccgccgc
gccaggttccggatgttcccgttcgtctactga

DBGET integrated database retrieval system