KEGG   Streptomyces rectiverticillatus: FGW37_16310
Entry
FGW37_16310       CDS       T06927                                 

Definition
(GenBank) hydrolase
  KO
K14630  two-component flavin-dependent monooxygenase [EC:1.14.14.-]
Organism
srk  Streptomyces rectiverticillatus
Pathway
srk01057  Biosynthesis of type II polyketide products
srk01100  Metabolic pathways
srk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srk00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    FGW37_16310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:srk01008]
    FGW37_16310
Enzymes [BR:srk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.-  
     FGW37_16310
Polyketide biosynthesis proteins [BR:srk01008]
 Polyketide tailoring proteins
  Oxygenase
   FGW37_16310
SSDB
Motif
Pfam: Acyl-CoA_dh_2 Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N
Other DBs
NCBI-ProteinID: QLE72948
Position
complement(3732448..3733614)
AA seq 388 aa
MTTTDTRESRDTTDAVAPTLLEAARAAAPLAAAHAEAAEADRRLAQPVVDAIVAAGFSSH
FAPAAQGGAAGTFAELLDASAALGEGCASAAWFASVTASAGRLTAYLPQEGREGVWAKGP
ETVVVAGLMPSGTAEPAPGGWRVTGTWNYVSAVDFSDWTLVAARVAGAEGTGVRVLAVPR
TDYAITDTWRVVGMRGTGSNTVVLDEVLVPDAYTVPLDVLLKGLAPDAAAACHRVPMKAA
NGVTLGGPLLGASRGALRRWRELVAAKLNAPAGAISGGSDHGTFEQLLARAEGEIDAAGL
LLERVARTTDTGAVDALGTARNGRDCALAAEMLATVADRLLRSAGTRAQAEGEELQRHWR
DVNCGAGHSGLQFPTAAGAYARLLNDSA
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgaccaccacggacaccagggaatccagggacaccacagacgccgtcgcaccgaccctg
ctcgaagcggcccgcgcggccgccccgctcgccgccgcgcacgcggaggccgcggaggcc
gaccgccggctcgcgcagcccgtggtggacgcgatcgtggccgccgggttctccagccac
ttcgccccggccgcccagggcggcgcggcggggacgttcgccgaactcctggacgcgtcc
gccgccctgggcgagggctgcgcgtccgcggcctggttcgcctcggtgaccgccagcgcc
gggcggctgaccgcctacctgccgcaggaggggcgcgagggcgtgtgggccaagggcccc
gagaccgtggtcgtcgcgggcctgatgccctcgggcaccgcagagcccgccccgggcggc
tggcgggtcaccggcacgtggaactacgtcagcgcggtcgacttctccgactggacgctg
gtcgccgcccgggtggccggggcggagggtacgggcgtacgggtcctcgccgtgccgcgc
acggactacgcgatcaccgacacctggcgcgtggtgggcatgcgcgggaccggcagcaac
accgtcgtgctcgacgaggtcctcgtgcccgacgcgtacaccgtcccgctcgacgtcctg
ctcaagggcctcgcgcccgatgcggccgcggcctgccaccgggtgccgatgaaggccgcc
aacggcgtcaccctcggcgggcccctgctcggcgcgagccggggtgcactgcgccgctgg
cgcgagctcgtagccgccaagctgaacgcccccgcgggcgccatttccgggggctccgac
cacggcacgttcgagcagctcctggcccgtgccgagggcgagatcgacgcggcggggctg
ctgctggagcgcgtcgcccgcaccaccgacaccggcgccgtcgacgcgctcggcaccgcc
cgcaacgggcgggactgcgcgctcgccgcggagatgctcgcgacggtcgccgaccggctg
ctgcgctcggccggcacccgggcgcaggccgagggcgaggagctccagcggcactggcgg
gacgtgaactgcggtgcgggccacagcggtctgcagttcccgacggcggcgggcgcgtac
gcccggctgctgaacgactccgcctga

DBGET integrated database retrieval system