KEGG   Serratia plymuthica 4Rx13: SOD_c00030Help
Entry
SOD_c00030        CDS       T02710                                 

Gene name
recF
Definition
(GenBank) DNA replication and repair protein RecF
  KO
K03629  DNA replication and repair protein RecF
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:srl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    SOD_c00030 (recF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:srl03400]
    SOD_c00030 (recF)
DNA repair and recombination proteins [BR:srl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     SOD_c00030 (recF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N AAA_15 AAA_21 AAA_23 AAA_27 AAA_29 ABC_tran AAA_16
Motif
Other DBs
NCBI-ProteinID: AGO53039
UniProt: S0AAJ1
Position
2753..3838
Genome map
AA seq 361 aa AA seqDB search
MALTRLLIKDFRNIEAADLALAPGFNFLVGANGSGKTSVLEAVYTLGHGRAFRSLQAGRV
IRHDQPEFILHGRIEGAEREISVGLSKSRQGDSKVRIDGSDGHKVAELAQLLPMQLITPE
GFTLLNGGPKFRRAFLDWGCFHNEPGFFTAWSNLKRLLKQRNAALRQVSRYAQIRAWDQE
LIPLAERISEWRAAYSDAIAADITATCAQFLPEFALSFSFQRGWDKESDYGELLERQFER
DRVLTYTAVGPHKADFRIRAEGTPVEDLLSRGQLKLLMCALRLAQGEFLTRQSGRRCLYL
IDDFASELDTGRRRLLADRLKATQAQVFVSAVSAEQVTDMAGEKGKMFRVEQGKIEVQPQ
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggctctgacgcgtttactgattaaagatttccgcaatatcgaagcggcggatttggct
ctggcgccgggattcaatttcctggttggggccaacggcagtgggaaaaccagcgtgctt
gaggcggtgtatacccttggccacgggcgcgcatttcgcagcctgcaggccggaagggtg
atccgccacgaccagccggagttcattttgcacggccgtattgaaggcgctgagcgtgaa
atatccgttggattaagcaagagccgtcagggagacagcaaagtgcgcatcgatggcagc
gacggccacaaagtggctgagctggcgcagttattgccgatgcagctgattacccccgaa
ggttttaccctgctaaacggcgggccgaaatttcggcgcgccttcctggactggggttgt
tttcataacgaacccggttttttcaccgcctggagcaacctgaaacggttactgaagcag
cgtaatgccgcgctgcgccaggtcagtcgctatgcgcagatccgcgcctgggatcaggaa
ttgatcccgttggccgagcgtatcagcgagtggcgggcagcttacagcgacgcgattgcc
gcggatatcaccgcgacgtgcgcgcagtttttgcccgaatttgccctgagtttctctttc
cagcgcggctgggacaaagagagcgactacggagagctgctggagcgccagtttgagcgc
gacagggtgttaacctataccgccgtggggccgcataaggcggacttccgcatccgtgcc
gagggcacgccggtagaggatttattatcgcgcggtcagctaaagctgctgatgtgcgcg
ttgcgcttagcgcagggtgagtttctcacccggcagagcgggcggcgttgcctgtatctg
attgatgattttgcctccgagctggacaccggccgtcgccggttgctggccgatcgcctg
aaagccacccaggcccaggtctttgtcagcgcggtaagcgctgaacaagtgaccgatatg
gccggtgaaaagggcaagatgttccgcgtggaacagggtaaaatagaggttcaaccacag
gactaa

DBGET integrated database retrieval system