KEGG   Serratia plymuthica 4Rx13: SOD_c00100Help
Entry
SOD_c00100        CDS       T02710                                 

Gene name
ibpA
Definition
(GenBank) small heat shock protein IbpA
  KO
K04080  molecular chaperone IbpA
Organism
srl  Serratia plymuthica 4Rx13
Brite
KEGG Orthology (KO) [BR:srl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:srl03110]
    SOD_c00100 (ibpA)
Chaperones and folding catalysts [BR:srl03110]
 Heat shock proteins
  HSP20
   SOD_c00100 (ibpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP20
Motif
Other DBs
NCBI-ProteinID: AGO53046
UniProt: S0A7U2
Position
11337..11750
Genome map
AA seq 137 aa AA seqDB search
MRNFDLSPLYRSAIGFDRLFNALEAGQSQGNGGYPPYNVELVDENHYRIAIAVAGFAEQE
LEITTQDNLLIVRGAHNNEPAERTYLYQGIAERNFERKFQLAEHIQIKGAKLENGLLYID
MERIVPETLKPRRIEIK
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaatttcgatctttccccgctataccgttccgccattggttttgaccgcttgttt
aacgcgctggaggctgggcagagccaggggaatggcggttacccaccttataacgttgag
ctggtggatgaaaaccattatcgcattgcgatcgcggtggccgggtttgccgagcaggaa
ctggagatcaccacccaggacaatcttctgattgtgcgtggtgcccataataacgaacct
gctgaaagaacctacttatatcaaggtattgccgagcgtaacttcgagcgtaaattccag
ctggccgagcatatccaaattaaaggcgcgaagctggagaatgggttgttgtatatcgat
atggaacgcatcgtaccggaaacattaaaaccgcgccgaattgaaattaaataa

DBGET integrated database retrieval system