KEGG   Serratia plymuthica 4Rx13: SOD_c00120Help
Entry
SOD_c00120        CDS       T02710                                 

Definition
(GenBank) putative transport protein
  KO
K07085  putative transport protein
Organism
srl  Serratia plymuthica 4Rx13
Brite
KEGG Orthology (KO) [BR:srl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SOD_c00120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp-Al_Ex TrkA_C
Motif
Other DBs
NCBI-ProteinID: AGO53048
UniProt: S0A7P2
Position
12451..14109
Genome map
AA seq 552 aa AA seqDB search
MSDIALTVSMLALVAVLGLWMGNWKVYGVGLGIGGVLFGGIIVGHFAQSWQISLNGDMLH
FIQEFGLILFVYTIGIQVGPGFFSSLRVSGLRLNGFAILLVLVGGVVAAGVHKLFAVPLP
IILGVFSGAVTNTPALGAGQQILTDLGSDPALVDRMGMGYAMAYPFGICGILLVMWLIRL
FFRINIDKEAQAFENSLGNHHELLHTMNVAVRNPNLQGMAIKNVPLLNGEDIVCSRLKRG
ELLMVPAPLERLELGDYLHLVGKRESLENARLVIGEEVDVSLSTRGTALQVVRAVVTNEK
VLGSKIRDLNLKRKYDVVISRLNRSGVELVAGSNVTLQFGDILNLVGRPESIEAVAAIVG
NAQQKLQQVQMLPVFIGIGLGVLLGSVPLFVPGFPAALRLGLAGGPLVAALILGRIGSIG
KLYWFMPPSANLALRELGIVLFLAVVGLKSGGNFVDTLMHGEGLAWIGYGALITAIPLLS
VGVLARVVGKMNYLTLSGMLAGSMTDPPALAFANGLHPTSGAAALSYATVYPLAMFLRIM
SPQLLAVLFWAM
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatatcgccctgaccgtcagcatgttggcgttggtggccgttctcgggctgtgg
atgggtaactggaaggtgtatggcgtcgggttgggcattggcggggtcctgttcggcggc
attatcgtggggcatttcgcccagagctggcaaatcagtcttaacggcgacatgctgcat
ttcattcaggaattcgggctgatcctgttcgtttacaccattggcattcaggtgggccca
ggtttcttttcttccctgcgggtgtccgggctgcggctcaatggtttcgccattttactg
gtgctggttggcggcgtggtggcggcgggggttcacaagctgtttgccgtgccgctgccg
atcattctcggcgtgttctccggagcggtcaccaatacccccgcgctcggtgccgggcag
caaattcttaccgatctggggtccgatccggcgttggtcgatcgcatggggatgggttac
gccatggcctatccgttcggtatctgcggcatcctgctggtgatgtggctgatccgcctg
ttctttcgtatcaatatcgataaggaagcgcaggcgtttgaaaacagcctgggcaatcac
cacgaactgctgcacaccatgaacgtggcggtgcgtaatcccaatctgcaggggatggcg
ataaaaaatgtgccgctgctgaatggggaggacatcgtctgctcacggctgaaacgcggc
gagctgctgatggtgcccgcgccgctcgagaggctggagttgggtgactatctgcatctg
gtaggaaagcgcgagagcctggaaaatgcccggctggtgattggcgaagaggtggacgtt
tcgttgtcaacgcgcggcacggcgttacaggtggtgagggcggtggtgaccaatgagaag
gtactgggcagcaaaatccgcgatctcaacctgaaacggaaatatgacgtggtgatctcg
cgcctgaaccgttccggggttgaactggtggccggcagcaacgttacgctgcaatttggc
gatatcctcaacctggttggccggccggaatcgattgaagcggtcgcggccatcgtcggc
aacgctcagcagaaattgcaacaggtgcagatgttgccggtatttatcggcatcgggctg
ggagtgttgctgggttctgtcccgctgtttgtaccgggtttcccggcggcattgcgcctt
gggctggccggcgggccgctggtggcggcattgatcctcgggcgtatcggcagcattggc
aagctgtactggtttatgccgccgagcgccaacctggcgctgcgcgagttgggcattgtg
ctgtttttggcggtggtggggctgaaatcgggggggaactttgtcgataccctgatgcat
ggcgaagggctggcgtggattggctacggcgcgttgattaccgctatcccgttgctcagc
gtgggtgtgctggcgcgggtcgtgggcaagatgaattatctgacgctgtccggcatgttg
gcaggttcgatgaccgatccgccggcgctggccttcgccaacggcctgcacccgaccagc
ggcgctgccgcgctgtcttatgccacggtttaccctttggcgatgttcctgcgcatcatg
tcgccgcagttgctggcggtgcttttttgggcgatgtag

DBGET integrated database retrieval system