KEGG   Serratia plymuthica 4Rx13: SOD_c00150Help
Entry
SOD_c00150        CDS       T02710                                 

Definition
(GenBank) CopG family transcriptional regulator
Organism
srl  Serratia plymuthica 4Rx13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RHH_1 RHH_5 TraY Arc RHH_3
Motif
Other DBs
NCBI-ProteinID: AGO53051
UniProt: S0A7U7
Position
17808..18047
Genome map
AA seq 79 aa AA seqDB search
MSVRLPEDLSEQLEALAKATGRTKSFLAGQAIRDFINREAWQIAEIQQAIAEADKGDFAS
DDEMEARFKKMGVIVNDEN
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttcgactaccggaagatctcagtgagcaattagaagctttggccaaagcgacc
ggcagaacaaaatcgtttctggccgggcaggctatccgtgatttcatcaaccgtgaagcc
tggcagattgcggaaattcaacaggccatcgctgaggcggataagggggactttgcttct
gatgatgaaatggaagcccgcttcaagaagatgggggtgattgttaacgatgaaaattaa

DBGET integrated database retrieval system