KEGG   Serratia plymuthica 4Rx13: SOD_c00190Help
Entry
SOD_c00190        CDS       T02710                                 

Gene name
kdgK1
Definition
(GenBank) 2-dehydro-3-deoxygluconokinase KdgK
  KO
K00874  2-dehydro-3-deoxygluconokinase [EC:2.7.1.45]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00030  Pentose phosphate pathway
srl01100  Metabolic pathways
srl01120  Microbial metabolism in diverse environments
srl01200  Carbon metabolism
Module
srl_M00061  D-Glucuronate degradation, D-glucuronate => pyruvate + D-glyceraldehyde 3P
Brite
KEGG Orthology (KO) [BR:srl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SOD_c00190 (kdgK1)
Enzymes [BR:srl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.45  2-dehydro-3-deoxygluconokinase
     SOD_c00190 (kdgK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: AGO53055
UniProt: S0AB60
Position
complement(20870..21829)
Genome map
AA seq 319 aa AA seqDB search
MTTLTAARNAPLDVVTLGEAMAMFVATQTGDLAEVETFTKRIAGAELNVAIGLARLGLNV
GWVSRVGNDAFGRFALQQLKKEGINFQQVTVDGNYPTGFQIKSKTTDGTDPSVEYFRKGS
AASHLSTADFNRDYFGSARHLHLSGVAAALSGQSLELCNHAAREMRAMGKTISFDPNLRP
VLWSSQQVMIDQLNKLAFAADWVLPGLKEGQILTGQSTPEGIADFYLERGVQAVIIKTGP
DGAWFKTAAGDRARVPAIKVSNVVDTVGAGDGFAVGTISALLEGKTLKQAVQRGNKIGSL
AIQAIGDSEGLPTRAALAE
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgctgacagcggcgcgtaatgcgccattggacgtagttacgctgggtgaggcc
atggcgatgttcgtggccacgcaaaccggcgatctggctgaagtcgagaccttcaccaaa
cgcatcgccggtgccgagctgaacgtggcgattggccttgcgcgcctgggtctgaacgtg
ggctgggtcagccgggtcggcaacgacgctttcggccgtttcgccctgcaacagctgaaa
aaagaaggcattaacttccagcaagtcacggtagacggcaactatccgaccggttttcag
atcaaatcgaaaactaccgatggtaccgatcccagcgtggagtatttccgtaaaggctca
gcggccagtcatttgtcgaccgccgactttaaccgcgattacttcggctccgcacgccat
ctgcacctgagcggcgtggctgcggccctgtccggtcaatcgctggagctgtgcaaccat
gccgcccgtgaaatgcgcgccatgggcaagaccatttcattcgatcccaacctgcgcccg
gtgctgtggtccagccaacaggtgatgatcgaccagttgaacaagctggcgttcgccgcc
gactgggtgctgccggggctcaaagaggggcaaatccttaccggccaatccacgccggaa
ggcatcgccgatttctacctggaacgcggcgtgcaagcggtgatcatcaaaaccggcccg
gacggcgcctggtttaaaaccgccgccggcgatcgggccagggtgccggcgataaaagtc
agcaacgtagtggataccgtaggtgcaggagacggctttgccgttgggacgatcagcgcc
ctgctggagggcaaaacgctgaagcaggcggtgcaacgcggcaataaaatcggctcgctg
gcgatccaggccatcggcgacagcgaagggttgccaacccgcgcggcactggctgaataa

DBGET integrated database retrieval system