KEGG   Serratia plymuthica 4Rx13: SOD_c00250Help
Entry
SOD_c00250        CDS       T02710                                 

Gene name
lip-1
Definition
(GenBank) lipase 1
  KO
K12686  outer membrane lipase/esterase
Organism
srl  Serratia plymuthica 4Rx13
Brite
KEGG Orthology (KO) [BR:srl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:srl02000]
    SOD_c00250 (lip-1)
   02044 Secretion system [BR:srl02044]
    SOD_c00250 (lip-1)
Transporters [BR:srl02000]
 Other Transporters
  Pores ion channels [TC:1]
   SOD_c00250 (lip-1)
Secretion system [BR:srl02044]
 Type V secretion system
  Autotransporter-1 (AT-1) family
   SOD_c00250 (lip-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Autotransporter Lipase_GDSL HsbA
Motif
Other DBs
NCBI-ProteinID: AGO53061
Position
25935..27923
Genome map
AA seq 662 aa AA seqDB search
MPLKITRMPRPAVLAVAILCSMTTPALAYDQVYVFGDSLSDTGNNGRFTYDGNKHLLYDE
VLAERIGAALVASDDGGYNYAAGGGVAVPALNPADNTQDQVQSYLGRVDGRADGDGLYIH
WIGGNDLAAAALNPTTASDVAYNSAAAAAVQVRSLLNAGAGTVIVPTVPNIGSTPQLMEL
IIQQALTPVQGAAVQAAYATLNSLTTPDNVSRTQAIHQALTSAAAQASAIPQVQQAIAAQ
LIAAFDSLSAQAAQLTDFYNQSEDRLLAQGGGNVVRVDVNKLFAEAIANPAQFGFANTAG
MACPAGVSSAVCSSATPGFDASQSYLFSDHFHPSPQAHLLIADYIQAVLDGPAQVVALNQ
ATAAMARDSRATLDSRFQQLRNGDNPQGSLGVFGGYAGQHYDYSANKAAGDGNATTHNLT
VGVDYQLAEGWLIGALISGSNDDQQPSSRYEYKARGLLLSAFTALDLFEHGWVNADLHYA
TMDYDDIRRSMQLGPLTRTETGSTSGKQWGARLTAGYDFPITSYLTTGPMAQFAWDYSNV
SGYSEDGNNSTSMRFNDQTYHSQIGALGWRLDSQFGLFNPYAEVSYQHQFGDDVYRAGGG
LKSTQTSFTRDSAGQDKNWVDVTLGANMPLTDQVAAFATVSQTGGLSSGEQFMYNVGVSA
RF
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaaaaataactcgcatgccccgcccggcggtgcttgcagtggcgatattatgc
agtatgactaccccggcgctggcctatgaccaggtttacgtatttggcgatagcctgagc
gataccggcaacaatggccgctttacctacgacggcaataaacacctgctgtatgacgaa
gtgctggcggaacgcatcggcgccgcgttggtggcgtcggacgacggcggctacaattat
gccgccggcggcggtgtggcggtgccggcgctcaacccggcggacaatactcaggatcag
gtgcagagctaccttggccgggtcgatggccgggccgatggcgacggtctgtatattcac
tggattggcggcaacgatctggcggcggcggcgttaaacccgacaaccgcgtcggacgtg
gcctataacagtgcagccgccgccgcagtgcaggttcgttcgctgttgaatgccggcgcc
ggtacggtgatcgtaccgacggtaccgaatattggttcaacgccgcagctgatggagctg
attatccagcaggcgctgacgccggtgcagggcgccgcagtacaggcggcctatgccacc
ctcaattcgctgactacgccggataatgtttcgcgcacccaggctatccatcaggcgctg
acttccgccgccgcacaggccagcgcaatcccgcaggtgcagcaggcgatcgccgcacag
ctgattgccgcctttgacagcctgagcgctcaggccgcgcagttgaccgatttttataac
cagagtgaggatcgcctgttggcgcagggcggtggcaatgttgttcgcgtcgacgtgaac
aagctgttcgccgaggcgatagccaatccggcgcagtttggcttcgccaataccgccggc
atggcttgtccggccggggtgtcgtcggcggtgtgcagctccgccacgccgggcttcgac
gccagtcagtcctatctgttctccgatcattttcaccccagcccgcaggcgcatctgttg
attgccgattacattcaggcggtgctggatggcccggcgcaggtggtggcgctgaatcag
gcgacggcggcgatggcgcgtgacagccgcgcgacgctcgacagccgtttccagcaattg
cgcaatggcgacaacccgcagggatcgctgggcgtcttcggtggctatgccgggcagcat
tatgattactcggccaataaggcggcgggcgacggcaacgccaccacccataatctgacg
gttggggtagattatcagttggccgaaggctggctgattggcgcgctgatatccggttcc
aatgacgatcagcagccgtccagccgctatgaatacaaggcgcgcggcctgctgttgtcg
gcctttaccgcccttgatctgtttgagcacggctgggtgaatgccgatctgcactacgcg
acgatggattacgacgatattcgccgcagcatgcagctcgggccgctaacccgcaccgaa
accggctcgacctccggcaagcagtggggcgcacgcctcaccgccggttatgatttcccg
atcacctcttatctgacgaccggtccaatggcgcagtttgcctgggattacagcaacgtc
tccggttacagcgaggatggcaacaacagtacctcaatgcgctttaacgatcagacctac
cattcgcagatcggcgcgttgggctggcggctggacagccaatttggcctgtttaacccg
tacgccgaagtcagctatcaacatcagtttggcgatgatgtctaccgggccggcggcggg
ctgaagtccacgcagacctcgttcacccgcgacagcgccggccaggataaaaactgggtg
gatgtgacgctgggggcgaacatgccgctgactgaccaggtggcggcgttcgccaccgtt
tcgcaaaccggcggcctgagcagcggcgagcagtttatgtataacgtcggcgtcagcgcg
cggttttga

DBGET integrated database retrieval system