KEGG   Serratia plymuthica 4Rx13: SOD_c00310Help
Entry
SOD_c00310        CDS       T02710                                 

Gene name
yiaF
Definition
(GenBank) YiaF
Organism
srl  Serratia plymuthica 4Rx13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3053
Motif
Other DBs
NCBI-ProteinID: AGO53067
UniProt: S0A9F4
Position
34787..35506
Genome map
AA seq 239 aa AA seqDB search
MAVGIQSRVFARWLAPVLALLVVMQLTACGDKEPEQRKAFVDYLQNTVMRSGAKIPTLSE
DQKQKFGNYAGDYAILVGFSQQLSKSLDASLTPALDQINQIRTAQDYMSKRDSLQQSVGA
LNLLGQQIQSAKSQADTSRAALKQPDDLKAVYNQVYDKIVTGPANALMPVIPTTASFVQD
LVQVGDFLRTQGNQVSFNNNGVQFRTSQQATQYNTMMSNLVAKQQDLLNAQKTVASVTQ
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggcggtagggatccagagcagagttttcgcgcgttggttggccccggtattggcattg
ttggtggtcatgcaattgactgcctgcggcgataaagagccggaacaacgcaaggcgttt
gttgattacttacagaatacggttatgcgcagcggcgcgaaaatcccgacgctgagcgaa
gatcagaagcagaaattcggcaactatgccggtgattacgccatcctggtcggtttttca
cagcagttgtccaaatcgctggatgccagcctgacgccggcgttggatcagattaaccag
atccgcaccgcgcaggattacatgagcaagcgcgattcgctgcagcaatccgttggggcg
ttgaacctgctgggccagcagattcagtctgccaagtcacaggcggacacctcccgggcg
gcgctgaagcaacctgacgatctgaaagccgtttataatcaagtgtatgacaagattgtt
accgggccggccaatgcgctgatgccggttatccctaccaccgccagtttcgttcaggat
ctggtgcaggtcggggatttcctgcgcactcagggcaatcaggtgagctttaacaataac
ggtgtgcagttccgtacttcgcagcaggcaacgcaatacaacaccatgatgtcgaatctg
gtggccaagcagcaggatttgctgaatgcacagaaaaccgtcgcgagcgtgacccagtaa

DBGET integrated database retrieval system