KEGG   Serratia plymuthica 4Rx13: SOD_c00370Help
Entry
SOD_c00370        CDS       T02710                                 

Gene name
yibL
Definition
(GenBank) YibL
  KO
K14762  ribosome-associated protein
Organism
srl  Serratia plymuthica 4Rx13
Brite
KEGG Orthology (KO) [BR:srl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:srl03009]
    SOD_c00370 (yibL)
Ribosome biogenesis [BR:srl03009]
 Prokaryotic Type
  Other maturation factors
   SOD_c00370 (yibL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2810 FlgN Tup_N Rnk_N
Motif
Other DBs
NCBI-ProteinID: AGO53073
UniProt: S0A7R7
Position
42098..42460
Genome map
AA seq 120 aa AA seqDB search
MKEKEKAEIKRLSDLLDALNHKDTAVIQQGNVDLIAQHTKEKEKLATEIERLKGVRVEKL
SAEAQKLSQLPFSREITKKEQADMGSLKKSARGLIVVHPMTALGREMGLKVVTGYAKKAF
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagaaagaaaaggcagagattaagcgccttagcgacctgctggacgcactgaat
cacaaagacacggcggtgatccaacagggcaatgtcgacctgattgcgcagcacaccaaa
gaaaaagagaagctggcgacggaaatcgaacgtctgaaaggcgtgcgcgtcgagaagctg
agtgcggaagcgcagaagctgagccaactgcccttcagccgtgaaatcaccaagaaagag
caggcggacatggggtcgttgaagaaaagcgcacgcggcctgatcgtggtgcacccgatg
accgcactgggccgtgagatgggcctgaaagtagtcaccggctacgccaaaaaagctttc
tga

DBGET integrated database retrieval system