KEGG   Serratia plymuthica 4Rx13: SOD_c00380Help
Entry
SOD_c00380        CDS       T02710                                 

Definition
(GenBank) putative methyltransferase
Organism
srl  Serratia plymuthica 4Rx13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_12 Methyltransf_23 Methyltransf_31 Ubie_methyltran Methyltransf_8 Methyltransf_29 FtsJ RrnaAD Methyltransf_PK DUF4414 DREV PCMT Methyltransf_9 CMAS
Motif
Other DBs
NCBI-ProteinID: AGO53074
UniProt: S0AAP4
Position
complement(42495..43274)
Genome map
AA seq 259 aa AA seqDB search
MTTPSHSIHHAAAVGYQANADRYVKGRPDYPPEIATWLREVIGLHAGMTVVDLGAGTGKF
TPRLLETGAQVIAVEPVAQMLEKLSAALPQVKTLAGTAESIPLPDESVDAVVCAQSFHWF
ATPQALAEIQRILKPGGKFGLVWNMRDARVSWVRKLNQIVDRHEGDAPRFYTGEWRKLFP
VKGFEALQEQVFMFGHQGAAEDVIYNRVRSTSFIAALPPQRQEEVIDQIRQLVAEEGELQ
GKETVTVPYQTKAYFTTKR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccccctctcattcgatccaccacgccgcagccgttggttatcaggccaatgcc
gaccgctacgtgaaagggcgaccggattatccgccggagatcgccacctggctgcgtgag
gttatcggcctgcacgccggcatgacggttgtcgacctcggcgccggcaccggcaaattc
accccgcgcctactggaaaccggcgcgcaggtgatcgccgtcgaaccggtagcgcaaatg
ctggaaaaactgtcggccgcgctgccgcaggtgaaaacgctggcgggcaccgccgagtcg
attccgctgccggacgaatcggtcgatgccgtagtctgcgcgcagtccttccactggttc
gccacgccgcaggcgctggctgaaattcagcgtatcctcaagcccggcggcaagttcggc
ctggtgtggaatatgcgcgatgcgcgcgtgagctgggtgcgcaagctgaatcagattgtc
gacagacacgaaggcgacgcgccgcgtttctacactggcgaatggcgcaaactgtttccg
gtcaaggggttcgaagcgttgcaggagcaggtgtttatgttcggccaccagggcgcagca
gaagatgtgatttacaaccgggtgcgctcaaccagctttatcgccgccttaccgccgcaa
cggcaggaagaggtgatcgatcagattcgccagttggtggcggaggaaggggaattgcag
ggcaaggaaacagtgaccgtgccctatcaaaccaaggcgtatttcacgaccaagcgatga

DBGET integrated database retrieval system