KEGG   Serratia plymuthica 4Rx13: SOD_c00440Help
Entry
SOD_c00440        CDS       T02710                                 

Gene name
fdoG
Definition
(GenBank) formate dehydrogenase-O major subunit FdoG
  KO
K00123  formate dehydrogenase major subunit [EC:1.17.1.9]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00630  Glyoxylate and dicarboxylate metabolism
srl00680  Methane metabolism
srl01100  Metabolic pathways
srl01120  Microbial metabolism in diverse environments
srl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:srl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SOD_c00440 (fdoG)
  09102 Energy metabolism
   00680 Methane metabolism
    SOD_c00440 (fdoG)
Enzymes [BR:srl01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.9  formate dehydrogenase
     SOD_c00440 (fdoG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdopterin
Motif
Other DBs
NCBI-ProteinID: AGO53080
Position
48505..50682
Genome map
AA seq 725 aa AA seqDB search
MTNHWVDIKNANLIIVMGGNAAEAHPVGFRWAMEAKIHNKAKLIVIDPRFTRTASVADFY
TPIRSGTDIAFLSGVLLYLITNNKINREYVEAYTNASLLVREDFTFEDGLFSGYDAENRK
YDKTTWNYQLDENGFAKRDVTLQDPRCVWNMLKQHVSRYTPEVVNNICGTPTEDFIKVCE
YIAETCVADKTASFLYALGWTQHSVGAQNIRTMAMIQLLLGNMGMAGGGVNALRGHSNIQ
GLTDLGLLSQSLPGYMTLPSEKQTDIDTYLKANTPKALLPGQVNYWSNYPKFFVSMMKSF
YGDKAQKDNGWGFDWLPKWDKGYDVLQYFEMMSQGKVNGYFCQGFNPVASFPNKNKVVAS
LSKLKFLVTIDPLNTETSNFWQNHGEFNDVDPSKIQTEVFRLPSTCFAEENGSIVNSGRW
LQWHWKGADAPGEAMNDGEILAGIFIRLREMYARDGGAVPEQVLNMTWDYLTPENPASEE
VAMESNGKALADILDADGKVLAKKGEQLSTFAHLRDDGTTASGCWIFAGSWTPAGNQMAR
RDNADPSGLGNTLGWAWAWPLNRRILYNRASADPQGKPWDPKRQLLEWDGAKWGGVDIPD
YSAAAPGSDVGPFIMQPEGMGRLFATDKMAEGPFPEHYEPFETPLGTNPLHPNVVSNPAA
RVFKDDLAAMGTSDKFPYVGTTYRLTEHFHYWTKHAQLNAIAQPEQFVEIGEKLAEKKAS
STAIR
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaccactgggttgatatcaagaacgcgaatctgattatcgtcatgggcggtaat
gcggcggaagcgcatccggtggggttccgctgggcgatggaagccaaaattcacaataaa
gccaagctgatcgtcatcgatccgcgctttacccgtaccgcatcggtggcggatttctac
acgccgatccgttccgggaccgacatcgctttcctgtcgggcgtgttgctgtacctgatc
accaacaacaaaatcaaccgcgagtacgtcgaggcctacaccaacgccagcctgctggtg
cgggaagactttaccttcgaagacggcttgttcagcggctacgacgcggaaaaccgcaaa
tacgacaaaaccacctggaattatcagctcgacgagaacggcttcgccaagcgcgacgtc
acgttgcaggatccgcgttgcgtgtggaacatgctcaaacagcacgtcagccgctatacg
ccggaggtggtgaacaatatctgcggcacgccgaccgaggatttcatcaaggtctgcgaa
tacatcgccgaaacctgcgtggcggataaaaccgcgtcgttcctctacgccctgggctgg
actcagcactcggtcggcgcgcagaacatccgcaccatggcgatgatccaactgctgctc
ggcaacatgggcatggcgggcggcggcgtcaacgcgctgcgcggccactccaatatccag
ggcttgaccgatctgggcctgctgtcgcaaagcctgccgggctatatgacgctgccgtcg
gagaaacagacggatatcgacacctacctgaaggccaacacgccgaaggcgctgctgccg
ggccaggtgaactactggagcaactacccgaaattcttcgtcagcatgatgaagagcttc
tacggcgacaaggcgcagaaggacaacggctggggctttgactggttgccgaagtgggac
aaaggctacgacgtactgcagtacttcgagatgatgtcgcaagggaaggtgaacggctat
ttctgccagggctttaacccggtcgcgtcgttcccgaacaaaaacaaggtcgtggcctcg
ctgtcgaagctgaagttcctggtgaccatagatccgctcaacaccgagacctccaacttc
tggcagaaccacggcgagttcaacgacgtcgatccgtcgaagattcagaccgaggtgttc
cgcctgccgtccacctgctttgccgaagaaaacggctcgatcgtcaactccggccgctgg
ctgcagtggcactggaaaggcgcggacgccccgggtgaggcgatgaacgacggggaaatc
ctggcgggcattttcatccgcctgcgcgagatgtacgcgcgtgacggcggcgcggtgcct
gaacaggtgctgaacatgacctgggattacctgacgccggaaaaccccgcttcggaagaa
gtggcgatggaaagcaacggcaaggcgctggcggacattctcgacgccgacggcaaagtg
ctggcgaaaaagggcgaacagctcagcaccttcgcccacctgcgcgacgacggcaccacc
gccagcggctgttggatcttcgccggcagctggacgccggccggcaaccagatggcgcgg
cgcgataacgccgatccgtccggcctcggcaacacgctgggttgggcctgggcctggccg
ctcaaccgccgcattctgtataaccgcgcttcggccgacccgcaggggaaaccctgggat
ccgaaacgtcagttgctggagtgggacggcgccaagtggggcggggtggatatcccggac
tacagcgccgccgcgccgggcagcgacgtcgggccgtttatcatgcagccggaaggcatg
ggccgcctgttcgccaccgacaaaatggcggaagggccgttcccggaacactacgagccg
ttcgaaacgccgctcggcaccaacccgctgcacccgaacgtggtgtccaacccggcggcg
cgcgtgttcaaggacgatctggcggcgatgggcacttccgacaagttcccgtatgtcggc
accacctatcgtctgaccgaacacttccactactggaccaagcacgcgcagctcaatgcc
atcgcgcagccggagcagtttgtggagatcggcgagaagctggcggagaaaaaggcatca
agcacggcgatacggtga

DBGET integrated database retrieval system